NCBP2 (NM_001042540) Human Mass Spec Standard
CAT#: PH321605
NCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_001036005)
View other "NCBP2" proteins (5)
| Need it in bulk or customized? Get a free quote | 
CNY 14250.00
Specifications
| Product Data | |
| Description | NCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_001036005) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC221605 | 
| Predicted MW | 11.8 kDa | 
| Protein Sequence | >RC221605 representing NM_001042540 Red=Cloning site Green=Tags(s) MSGGLLKALRSDSYVELSQYRDQHFRGDNEEQEKLLKKSYAENAMRYINGTRLDDRIIRTDWDAGFKEGR QYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQNQ SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV | 
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_001036005 | 
| RefSeq Size | 2016 | 
| RefSeq ORF | 309 | 
| Synonyms | CBC2; CBP20; NIP1; PIG55 | 
| Locus ID | 22916 | 
| Cytogenetics | 3q29 | 
| Summary | The product of this gene is a component of the nuclear cap-binding protein complex (CBC), which binds to the monomethylated 5' cap of nascent pre-mRNA in the nucleoplasm. The encoded protein has an RNP domain commonly found in RNA binding proteins, and contains the cap-binding activity. The CBC promotes pre-mRNA splicing, 3'-end processing, RNA nuclear export, and nonsense-mediated mRNA decay. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] | 
| Protein Families | Druggable Genome | 
| Protein Pathways | Spliceosome | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC402134 | NCBP2 HEK293T cell transient overexpression lysate (as WB positive control) | CNY 900.00 | |
| LY402134 | Transient overexpression lysate of nuclear cap binding protein subunit 2, 20kDa (NCBP2), transcript variant 1 | CNY 3080.00 | |
| PH301519 | NCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_031388) | CNY 19520.00 | |
| TP301519 | Recombinant protein of human nuclear cap binding protein subunit 2, 20kDa (NCBP2), transcript variant 1, 20 µg | 
                                                        
                                                        
                                                        
                                                            CNY 2900.00 | |
| TP321605 | Purified recombinant protein of Homo sapiens nuclear cap binding protein subunit 2, 20kDa (NCBP2), transcript variant 2, 20 µg | 
                                                        
                                                        
                                                        
                                                            CNY 2900.00 | 

 
                        


 
        