NCBP2 (NM_001042540) Human Recombinant Protein
CAT#: TP321605
Purified recombinant protein of Homo sapiens nuclear cap binding protein subunit 2, 20kDa (NCBP2), transcript variant 2, 20 µg
View other "NCBP2" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC221605 representing NM_001042540
Red=Cloning site Green=Tags(s) MSGGLLKALRSDSYVELSQYRDQHFRGDNEEQEKLLKKSYAENAMRYINGTRLDDRIIRTDWDAGFKEGR QYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQNQ SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 11.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001036005 |
Locus ID | 22916 |
UniProt ID | P52298 |
Refseq Size | 2016 |
Cytogenetics | 3q29 |
Refseq ORF | 309 |
Synonyms | CBC2; CBP20; NIP1; PIG55 |
Summary | The product of this gene is a component of the nuclear cap-binding protein complex (CBC), which binds to the monomethylated 5' cap of nascent pre-mRNA in the nucleoplasm. The encoded protein has an RNP domain commonly found in RNA binding proteins, and contains the cap-binding activity. The CBC promotes pre-mRNA splicing, 3'-end processing, RNA nuclear export, and nonsense-mediated mRNA decay. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Spliceosome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402134 | NCBP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402134 | Transient overexpression lysate of nuclear cap binding protein subunit 2, 20kDa (NCBP2), transcript variant 1 |
CNY 3080.00 |
|
PH301519 | NCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_031388) |
CNY 19520.00 |
|
PH321605 | NCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_001036005) |
CNY 14250.00 |
|
TP301519 | Recombinant protein of human nuclear cap binding protein subunit 2, 20kDa (NCBP2), transcript variant 1, 20 µg |
CNY 2900.00 |