TFIIS (TCEA2) (NM_003195) Human Mass Spec Standard
CAT#: PH322661
TCEA2 MS Standard C13 and N15-labeled recombinant protein (NP_003186)
View other "TFIIS" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | TCEA2 MS Standard C13 and N15-labeled recombinant protein (NP_003186) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC222661 |
| Predicted MW | 33.6 kDa |
| Protein Sequence |
>RC222661 protein sequence
Red=Cloning site Green=Tags(s) MMGKEEEIARIARRLDKMVTKKSAEGAMDLLRELKAMPITLHLLQSTRVGMSVNALRKQSSDEEVIALAK SLIKSWKKLLDASDAKARERGRGMPLPTSSRDASEAPDPSRKRPELPRAPSTPRITTFPPVPVTCDAVRN KCREMLTAALQTDHDHVAIGADCERLSAQIEECIFRDVGNTDMKYKNRVRSRISNLKDAKNPDLRRNVLC GAITPQQIAVMTSEEMASDELKEIRKAMTKEAIREHQMARTGGTQTDLFTCGKCRKKNCTYTQVQTRSSD EPMTTFVVCNECGNRWKFC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003186 |
| RefSeq Size | 1749 |
| RefSeq ORF | 897 |
| Synonyms | TFIIS |
| Locus ID | 6919 |
| Cytogenetics | 20q13.33 |
| Summary | The protein encoded by this gene is found in the nucleus, where it functions as an SII class transcription elongation factor. Elongation factors in this class are responsible for releasing RNA polymerase II ternary complexes from transcriptional arrest at template-encoded arresting sites. The encoded protein has been shown to interact with general transcription factor IIB, a basal transcription factor. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404791 | TCEA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC418837 | TCEA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404791 | Transient overexpression lysate of transcription elongation factor A (SII), 2 (TCEA2), transcript variant 2 |
CNY 3080.00 |
|
| LY418837 | Transient overexpression lysate of transcription elongation factor A (SII), 2 (TCEA2), transcript variant 1 |
CNY 3080.00 |
|
| TP322661 | Recombinant protein of human transcription elongation factor A (SII), 2 (TCEA2), transcript variant 1, 20 µg |
CNY 2900.00 |
