TFIIS (TCEA2) (NM_003195) Human Recombinant Protein
CAT#: TP322661
Recombinant protein of human transcription elongation factor A (SII), 2 (TCEA2), transcript variant 1, 20 µg
View other "TFIIS" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC222661 protein sequence
Red=Cloning site Green=Tags(s) MMGKEEEIARIARRLDKMVTKKSAEGAMDLLRELKAMPITLHLLQSTRVGMSVNALRKQSSDEEVIALAK SLIKSWKKLLDASDAKARERGRGMPLPTSSRDASEAPDPSRKRPELPRAPSTPRITTFPPVPVTCDAVRN KCREMLTAALQTDHDHVAIGADCERLSAQIEECIFRDVGNTDMKYKNRVRSRISNLKDAKNPDLRRNVLC GAITPQQIAVMTSEEMASDELKEIRKAMTKEAIREHQMARTGGTQTDLFTCGKCRKKNCTYTQVQTRSSD EPMTTFVVCNECGNRWKFC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 33.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003186 |
Locus ID | 6919 |
UniProt ID | Q15560 |
Refseq Size | 1749 |
Cytogenetics | 20q13.33 |
Refseq ORF | 897 |
Synonyms | TFIIS |
Summary | The protein encoded by this gene is found in the nucleus, where it functions as an SII class transcription elongation factor. Elongation factors in this class are responsible for releasing RNA polymerase II ternary complexes from transcriptional arrest at template-encoded arresting sites. The encoded protein has been shown to interact with general transcription factor IIB, a basal transcription factor. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404791 | TCEA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418837 | TCEA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404791 | Transient overexpression lysate of transcription elongation factor A (SII), 2 (TCEA2), transcript variant 2 |
CNY 3080.00 |
|
LY418837 | Transient overexpression lysate of transcription elongation factor A (SII), 2 (TCEA2), transcript variant 1 |
CNY 3080.00 |
|
PH322661 | TCEA2 MS Standard C13 and N15-labeled recombinant protein (NP_003186) |
CNY 19520.00 |