AKR1D1 (NM_005989) Human Mass Spec Standard
CAT#: PH323056
AKR1D1 MS Standard C13 and N15-labeled recombinant protein (NP_005980)
View other "AKR1D1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | AKR1D1 MS Standard C13 and N15-labeled recombinant protein (NP_005980) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC223056 |
Predicted MW | 37.2 kDa |
Protein Sequence |
>RC223056 representing NM_005989
Red=Cloning site Green=Tags(s) MDLSAASHRIPLSDGNSIPIIGLGTYSEPKSTPKGACATSVKVAIDTGYRHIDGAYIYQNEHEVGEAIRE KIAEGKVRREDIFYCGKLWATNHVPEMVRPTLERTLRVLQLDYVDLYIIEVPMAFKPGDEIYPRDENGKW LYHKSNLCATWEAMEACKDAGLVKSLGVSNFNRRQLELILNKPGLKHKPVSNQVECHPYFTQPKLLKFCQ QHDIVITAYSPLGTSRNPIWVNVSSPPLLKDALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERI KENFQIFDFSLTEEEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005980 |
RefSeq Size | 2692 |
RefSeq ORF | 978 |
Synonyms | 3o5bred; CBAS2; SRD5B1 |
Locus ID | 6718 |
Cytogenetics | 7q33 |
Summary | The enzyme encoded by this gene is responsible for the catalysis of the 5-beta-reduction of bile acid intermediates and steroid hormones carrying a delta(4)-3-one structure. Deficiency of this enzyme may contribute to hepatic dysfunction. Three transcript variants encoding different isoforms have been found for this gene. Other variants may be present, but their full-length natures have not been determined yet. [provided by RefSeq, Jul 2010] |
Protein Families | Druggable Genome |
Protein Pathways | Androgen and estrogen metabolism, C21-Steroid hormone metabolism, Metabolic pathways, Primary bile acid biosynthesis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401810 | AKR1D1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC434125 | AKR1D1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC434132 | AKR1D1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401810 | Transient overexpression lysate of aldo-keto reductase family 1, member D1 (delta 4-3-ketosteroid-5-beta-reductase) (AKR1D1) |
CNY 3080.00 |
|
LY434125 | Transient overexpression lysate of aldo-keto reductase family 1, member D1 (delta 4-3-ketosteroid-5-beta-reductase) (AKR1D1), transcript variant 2 |
CNY 3080.00 |
|
LY434132 | Transient overexpression lysate of aldo-keto reductase family 1, member D1 (delta 4-3-ketosteroid-5-beta-reductase) (AKR1D1), transcript variant 3 |
CNY 3080.00 |
|
TP323056 | Recombinant protein of human aldo-keto reductase family 1, member D1 (delta 4-3-ketosteroid-5-beta-reductase) (AKR1D1), 20 µg |
CNY 2900.00 |