AKR1D1 (NM_005989) Human Recombinant Protein
CAT#: TP323056
Recombinant protein of human aldo-keto reductase family 1, member D1 (delta 4-3-ketosteroid-5-beta-reductase) (AKR1D1), 20 µg
View other "AKR1D1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC223056 representing NM_005989
Red=Cloning site Green=Tags(s) MDLSAASHRIPLSDGNSIPIIGLGTYSEPKSTPKGACATSVKVAIDTGYRHIDGAYIYQNEHEVGEAIRE KIAEGKVRREDIFYCGKLWATNHVPEMVRPTLERTLRVLQLDYVDLYIIEVPMAFKPGDEIYPRDENGKW LYHKSNLCATWEAMEACKDAGLVKSLGVSNFNRRQLELILNKPGLKHKPVSNQVECHPYFTQPKLLKFCQ QHDIVITAYSPLGTSRNPIWVNVSSPPLLKDALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERI KENFQIFDFSLTEEEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 37.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_005980 |
| Locus ID | 6718 |
| UniProt ID | P51857 |
| Refseq Size | 2692 |
| Cytogenetics | 7q33 |
| Refseq ORF | 978 |
| Synonyms | 3o5bred; CBAS2; SRD5B1 |
| Summary | The enzyme encoded by this gene is responsible for the catalysis of the 5-beta-reduction of bile acid intermediates and steroid hormones carrying a delta(4)-3-one structure. Deficiency of this enzyme may contribute to hepatic dysfunction. Three transcript variants encoding different isoforms have been found for this gene. Other variants may be present, but their full-length natures have not been determined yet. [provided by RefSeq, Jul 2010] |
| Protein Families | Druggable Genome |
| Protein Pathways | Androgen and estrogen metabolism, C21-Steroid hormone metabolism, Metabolic pathways, Primary bile acid biosynthesis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401810 | AKR1D1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC434125 | AKR1D1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC434132 | AKR1D1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401810 | Transient overexpression lysate of aldo-keto reductase family 1, member D1 (delta 4-3-ketosteroid-5-beta-reductase) (AKR1D1) |
CNY 3080.00 |
|
| LY434125 | Transient overexpression lysate of aldo-keto reductase family 1, member D1 (delta 4-3-ketosteroid-5-beta-reductase) (AKR1D1), transcript variant 2 |
CNY 3080.00 |
|
| LY434132 | Transient overexpression lysate of aldo-keto reductase family 1, member D1 (delta 4-3-ketosteroid-5-beta-reductase) (AKR1D1), transcript variant 3 |
CNY 3080.00 |
|
| PH323056 | AKR1D1 MS Standard C13 and N15-labeled recombinant protein (NP_005980) |
CNY 19520.00 |

