HOMER3 (NM_001145722) Human Mass Spec Standard
CAT#: PH326668
HOMER3 MS Standard C13 and N15-labeled recombinant protein (NP_001139194)
View other "HOMER3" proteins (13)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | HOMER3 MS Standard C13 and N15-labeled recombinant protein (NP_001139194) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC226668 |
Predicted MW | 39.9 kDa |
Protein Sequence |
>RC226668 protein sequence
Red=Cloning site Green=Tags(s) MSTAREQPIFSTRAHVFQIDPATKRNWIPAGKHALTVSYFYDATRNVYRIISIGGAKAIINSTVTPNMTF TKTSQKFGQWADSRANTVYGLGFASEQHLTQFAEKFQEVKEAARLAREKSQDGGELTSPALGLASHQVPP SPLVSANGPGEEKLFRSQSADAPGPTERERLKKMLSEGSVGEVQWEAEFFALQDSNNKLAGALREANAAA AQWRQQLEAQRAEAERLRQRVAELEAQAASEVTPTGEKEGLGQGQSLEQLEALVQTKDQEIQTLKSQTGG PREALEAAEREETQQKVQDLETRNAELEHQLRAMERSLEEARAERERARAEVGRAAQLLDVRLFELSELR EGLARLAEAAP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001139194 |
RefSeq Size | 1859 |
RefSeq ORF | 1083 |
Synonyms | HOMER-3; VESL3 |
Locus ID | 9454 |
Cytogenetics | 19p13.11 |
Summary | This gene encodes a member of the HOMER family of postsynaptic density scaffolding proteins that share a similar domain structure consisting of an N-terminal Enabled/vasodilator-stimulated phosphoprotein homology 1 domain which mediates protein-protein interactions, and a carboxy-terminal coiled-coil domain and two leucine zipper motifs that are involved in self-oligomerization. The encoded protein binds numerous other proteins including group I metabotropic glutamate receptors, inositol 1,4,5-trisphosphate receptors and amyloid precursor proteins and has been implicated in diverse biological functions such as neuronal signaling, T-cell activation and trafficking of amyloid beta peptides. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Mar 2009] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417705 | HOMER3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428985 | HOMER3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428986 | HOMER3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428987 | HOMER3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417705 | Transient overexpression lysate of homer homolog 3 (Drosophila) (HOMER3), transcript variant 2 |
CNY 3080.00 |
|
LY428985 | Transient overexpression lysate of homer homolog 3 (Drosophila) (HOMER3), transcript variant 3 |
CNY 3080.00 |
|
LY428986 | Transient overexpression lysate of homer homolog 3 (Drosophila) (HOMER3), transcript variant 1 |
CNY 3080.00 |
|
LY428987 | Transient overexpression lysate of homer homolog 3 (Drosophila) (HOMER3), transcript variant 4 |
CNY 3080.00 |
|
PH304168 | HOMER3 MS Standard C13 and N15-labeled recombinant protein (NP_004829) |
CNY 19520.00 |
|
PH326721 | HOMER3 MS Standard C13 and N15-labeled recombinant protein (NP_001139196) |
CNY 14250.00 |
|
TP304168 | Recombinant protein of human homer homolog 3 (Drosophila) (HOMER3), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP326668 | Recombinant protein of human homer homolog 3 (Drosophila) (HOMER3), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP326721 | Purified recombinant protein of Homo sapiens homer homolog 3 (Drosophila) (HOMER3), transcript variant 4, 20 µg |
CNY 2900.00 |