HOMER3 (NM_001145724) Human Mass Spec Standard
CAT#: PH326721
HOMER3 MS Standard C13 and N15-labeled recombinant protein (NP_001139196)
View other "HOMER3" proteins (13)
| Need it in bulk or customized? Get a free quote | 
CNY 14250.00
Specifications
| Product Data | |
| Description | HOMER3 MS Standard C13 and N15-labeled recombinant protein (NP_001139196) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC226721 | 
| Predicted MW | 35.8 kDa | 
| Protein Sequence | >RC226721 representing NM_001145724 Red=Cloning site Green=Tags(s) MSTAREQPIFSTRAHVFQIDPATKRNWIPAGKHALTVSYFYDATRNVYRIISIGGAKAIINSTVTPNMTF TKTSQKFGQWADSRANTVYGLGFASEQHLTQVPPSPLVSANGPGEEKLFRSQSADAPGPTERERLKKMLS EGSVGEVQWEAEFFALQDSNNKLAGALREANAAAAQWRQQLEAQRAEAERLRQRVAELEAQAASEVTPTG EKEGLGQGQSLEQLEALVQTKDQEIQTLKSQTGGPREALEAAEREETQQKVQDLETRNAELEHQLRAMER SLEEARAERERARAEVGRAAQLLDVSLFELSELREGLARLAEAAP myc-FLAG tag | 
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_001139196 | 
| RefSeq ORF | 975 | 
| Synonyms | HOMER-3; VESL3 | 
| Locus ID | 9454 | 
| Cytogenetics | 19p13.11 | 
| Summary | This gene encodes a member of the HOMER family of postsynaptic density scaffolding proteins that share a similar domain structure consisting of an N-terminal Enabled/vasodilator-stimulated phosphoprotein homology 1 domain which mediates protein-protein interactions, and a carboxy-terminal coiled-coil domain and two leucine zipper motifs that are involved in self-oligomerization. The encoded protein binds numerous other proteins including group I metabotropic glutamate receptors, inositol 1,4,5-trisphosphate receptors and amyloid precursor proteins and has been implicated in diverse biological functions such as neuronal signaling, T-cell activation and trafficking of amyloid beta peptides. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Mar 2009] | 
| Protein Families | Druggable Genome | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC417705 | HOMER3 HEK293T cell transient overexpression lysate (as WB positive control) | CNY 900.00 | |
| LC428985 | HOMER3 HEK293T cell transient overexpression lysate (as WB positive control) | CNY 900.00 | |
| LC428986 | HOMER3 HEK293T cell transient overexpression lysate (as WB positive control) | CNY 900.00 | |
| LC428987 | HOMER3 HEK293T cell transient overexpression lysate (as WB positive control) | CNY 900.00 | |
| LY417705 | Transient overexpression lysate of homer homolog 3 (Drosophila) (HOMER3), transcript variant 2 | CNY 3080.00 | |
| LY428985 | Transient overexpression lysate of homer homolog 3 (Drosophila) (HOMER3), transcript variant 3 | CNY 3080.00 | |
| LY428986 | Transient overexpression lysate of homer homolog 3 (Drosophila) (HOMER3), transcript variant 1 | CNY 3080.00 | |
| LY428987 | Transient overexpression lysate of homer homolog 3 (Drosophila) (HOMER3), transcript variant 4 | CNY 3080.00 | |
| PH304168 | HOMER3 MS Standard C13 and N15-labeled recombinant protein (NP_004829) | CNY 19520.00 | |
| PH326668 | HOMER3 MS Standard C13 and N15-labeled recombinant protein (NP_001139194) | CNY 19520.00 | |
| TP304168 | Recombinant protein of human homer homolog 3 (Drosophila) (HOMER3), transcript variant 2, 20 µg | 
                                                        
                                                        
                                                        
                                                            CNY 2900.00 | |
| TP326668 | Recombinant protein of human homer homolog 3 (Drosophila) (HOMER3), transcript variant 1, 20 µg | 
                                                        
                                                        
                                                        
                                                            CNY 2900.00 | |
| TP326721 | Purified recombinant protein of Homo sapiens homer homolog 3 (Drosophila) (HOMER3), transcript variant 4, 20 µg | 
                                                        
                                                        
                                                        
                                                            CNY 2900.00 | 

 
                        

 
        