DOHH (NM_001145165) Human Mass Spec Standard
CAT#: PH326938
DOHH MS Standard C13 and N15-labeled recombinant protein (NP_001138637)
View other "DOHH" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | DOHH MS Standard C13 and N15-labeled recombinant protein (NP_001138637) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC226938 |
Predicted MW | 32.7 kDa |
Protein Sequence |
>RC226938 representing NM_001145165
Red=Cloning site Green=Tags(s) MVTEQEVDAIGQTLVDPKQPLQARFRALFTLRGLGGPGAIAWISQAFDDDSALLKHELAYCLGQMQDARA IPMLVDVLQDTRQEPMVRHEAGEALGAIGDPEVLEILKQYSSDPVIEVAETCQLAVRRLEWLQQHGGEPA AGPYLSVDPAPPAEERDVGRLREALLDESRPLFERYRAMFALRNAGGEEAALALAEGLHCGSALFRHEVG YVLGQLQHEAAVPQLAAALARCTENPMVRHECAEALGAIARPACLAALQAHADDPERVVRESCEVALDMY EHETGRAFQYADGLEQLRGAPS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001138637 |
RefSeq ORF | 906 |
Synonyms | hDOHH; HLRC1 |
Locus ID | 83475 |
Cytogenetics | 19p13.3 |
Summary | This gene encodes a metalloenzyme that catalyzes the last step in the conversion of lysine to the unique amino acid hypusine in eukaryotic initiation factor 5A. The encoded protein hydroxylates deoxyhypusine to form hypusine in the mature eukaryotic initiation factor 5A protein. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Feb 2009] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410554 | DOHH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428737 | DOHH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410554 | Transient overexpression lysate of deoxyhypusine hydroxylase/monooxygenase (DOHH), transcript variant 2 |
CNY 3080.00 |
|
LY428737 | Transient overexpression lysate of deoxyhypusine hydroxylase/monooxygenase (DOHH), transcript variant 1 |
CNY 3080.00 |
|
PH301340 | DOHH MS Standard C13 and N15-labeled recombinant protein (NP_112594) |
CNY 19520.00 |
|
TP301340 | Recombinant protein of human deoxyhypusine hydroxylase/monooxygenase (DOHH), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP326938 | Recombinant protein of human deoxyhypusine hydroxylase/monooxygenase (DOHH), transcript variant 1, 20 µg |
CNY 2900.00 |