DOHH (NM_001145165) Human Recombinant Protein
CAT#: TP326938
Recombinant protein of human deoxyhypusine hydroxylase/monooxygenase (DOHH), transcript variant 1, 20 µg
View other "DOHH" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC226938 representing NM_001145165
Red=Cloning site Green=Tags(s) MVTEQEVDAIGQTLVDPKQPLQARFRALFTLRGLGGPGAIAWISQAFDDDSALLKHELAYCLGQMQDARA IPMLVDVLQDTRQEPMVRHEAGEALGAIGDPEVLEILKQYSSDPVIEVAETCQLAVRRLEWLQQHGGEPA AGPYLSVDPAPPAEERDVGRLREALLDESRPLFERYRAMFALRNAGGEEAALALAEGLHCGSALFRHEVG YVLGQLQHEAAVPQLAAALARCTENPMVRHECAEALGAIARPACLAALQAHADDPERVVRESCEVALDMY EHETGRAFQYADGLEQLRGAPS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 32.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001138637 |
| Locus ID | 83475 |
| UniProt ID | Q9BU89 |
| Cytogenetics | 19p13.3 |
| Refseq ORF | 906 |
| Synonyms | hDOHH; HLRC1 |
| Summary | This gene encodes a metalloenzyme that catalyzes the last step in the conversion of lysine to the unique amino acid hypusine in eukaryotic initiation factor 5A. The encoded protein hydroxylates deoxyhypusine to form hypusine in the mature eukaryotic initiation factor 5A protein. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Feb 2009] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410554 | DOHH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428737 | DOHH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410554 | Transient overexpression lysate of deoxyhypusine hydroxylase/monooxygenase (DOHH), transcript variant 2 |
CNY 3080.00 |
|
| LY428737 | Transient overexpression lysate of deoxyhypusine hydroxylase/monooxygenase (DOHH), transcript variant 1 |
CNY 3080.00 |
|
| PH301340 | DOHH MS Standard C13 and N15-labeled recombinant protein (NP_112594) |
CNY 19520.00 |
|
| PH326938 | DOHH MS Standard C13 and N15-labeled recombinant protein (NP_001138637) |
CNY 19520.00 |
|
| TP301340 | Recombinant protein of human deoxyhypusine hydroxylase/monooxygenase (DOHH), transcript variant 2, 20 µg |
CNY 2900.00 |
