NEIL2 (NM_001135746) Human Mass Spec Standard
CAT#: PH327701
NEIL2 MS Standard C13 and N15-labeled recombinant protein (NP_001129218)
View other "NEIL2" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | NEIL2 MS Standard C13 and N15-labeled recombinant protein (NP_001129218) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC227701 |
| Predicted MW | 36.8 kDa |
| Protein Sequence |
>RC227701 protein sequence
Red=Cloning site Green=Tags(s) MPEGPLVRKFHHLVSPFVGQQVVKTGGSSKKLQPASLQSLWLQDTQVHGKKLFLRFDLDEEMGPPGSSPT PEPPQKEVQKEGAADPKQVGEPSGQKTLDGSSRSAELVPQGEDDSEYLERDAPAGDAGRWLRVSFGLFGS VWVNDFSRAKKANKRGDWRDPSPRLVLHFGGGGFLAFYNCQLSWSSSPVVTPTCDILSEKFHRGQALEAL GQAQPVCYTLLDQRYFSGLGNIIKNEALYRAGIHPLSLGSVLSASRREVLVDHVVEFSTAWLQGKFQGRP QHTQVYQKEQCPAGHQVMKEAFGPEDGLQRLTWWCPQCQPQLSEEPEQCQFS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001129218 |
| RefSeq Size | 2202 |
| RefSeq ORF | 996 |
| Synonyms | NEH2; NEI2 |
| Locus ID | 252969 |
| Cytogenetics | 8p23.1 |
| Summary | This gene encodes a member of the Fpg/Nei family of DNA glycosylases. These glycosylases initiate the first step in base excision repair by cleaving oxidatively damaged bases and introducing a DNA strand break via their abasic site lyase activity. This enzyme is primarily associated with DNA repair during transcription and acts prefentially on cytosine-derived lesions, particularly 5-hydroxyuracil and 5-hydroxycytosine. It contains an N-terminal catalytic domain, a hinge region, and a C-terminal DNA-binding domain with helix-two-turn-helix and zinc finger motifs. This enzyme interacts with the X-ray cross complementing factor 1 scaffold protein as part of a multi-protein DNA repair complex. A pseudogene of this gene has been identified. [provided by RefSeq, Mar 2017] |
| Protein Families | Druggable Genome |
| Protein Pathways | Base excision repair |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408061 | NEIL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427692 | NEIL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427694 | NEIL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408061 | Transient overexpression lysate of nei like 2 (E. coli) (NEIL2), transcript variant 1 |
CNY 3080.00 |
|
| LY427692 | Transient overexpression lysate of nei like 2 (E. coli) (NEIL2), transcript variant 2 |
CNY 3080.00 |
|
| LY427694 | Transient overexpression lysate of nei like 2 (E. coli) (NEIL2), transcript variant 4 |
CNY 3080.00 |
|
| PH300913 | NEIL2 MS Standard C13 and N15-labeled recombinant protein (NP_659480) |
CNY 19520.00 |
|
| TP300913 | Recombinant protein of human nei like 2 (E. coli) (NEIL2), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP327701 | Recombinant protein of human nei like 2 (E. coli) (NEIL2), transcript variant 2, 20 µg |
CNY 2900.00 |
