NEIL2 (NM_145043) Human Recombinant Protein
CAT#: TP300913
Recombinant protein of human nei like 2 (E. coli) (NEIL2), transcript variant 1, 20 µg
View other "NEIL2" proteins (9)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200913 protein sequence
Red=Cloning site Green=Tags(s) MPEGPLVRKFHHLVSPFVGQQVVKTGGSSKKLQPASLQSLWLQDTQVHGKKLFLRFDLDEEMGPPGSSPT PEPPQKEVQKEGAADPKQVGEPSGQKTLDGSSRSAELVPQGEDDSEYLERDAPAGDAGRWLRVSFGLFGS VWVNDFSRAKKANKRGDWRDPSPRLVLHFGGGGFLAFYNCQLSWSSSPVVTPTCDILSEKFHRGQALEAL GQAQPVCYTLLDQRYFSGLGNIIKNEALYRAGIHPLSLGSVLSASRREVLVDHVVEFSTAWLQGKFQGRP QHTQVYQKEQCPAGHQVMKEAFGPEDGLQRLTWWCPQCQPQLSEEPEQCQFS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 36.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_659480 |
| Locus ID | 252969 |
| UniProt ID | Q969S2 |
| Refseq Size | 2746 |
| Cytogenetics | 8p23.1 |
| Refseq ORF | 996 |
| Synonyms | NEH2; NEI2 |
| Summary | This gene encodes a member of the Fpg/Nei family of DNA glycosylases. These glycosylases initiate the first step in base excision repair by cleaving oxidatively damaged bases and introducing a DNA strand break via their abasic site lyase activity. This enzyme is primarily associated with DNA repair during transcription and acts prefentially on cytosine-derived lesions, particularly 5-hydroxyuracil and 5-hydroxycytosine. It contains an N-terminal catalytic domain, a hinge region, and a C-terminal DNA-binding domain with helix-two-turn-helix and zinc finger motifs. This enzyme interacts with the X-ray cross complementing factor 1 scaffold protein as part of a multi-protein DNA repair complex. A pseudogene of this gene has been identified. [provided by RefSeq, Mar 2017] |
| Protein Families | Druggable Genome |
| Protein Pathways | Base excision repair |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408061 | NEIL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427692 | NEIL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427694 | NEIL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408061 | Transient overexpression lysate of nei like 2 (E. coli) (NEIL2), transcript variant 1 |
CNY 3080.00 |
|
| LY427692 | Transient overexpression lysate of nei like 2 (E. coli) (NEIL2), transcript variant 2 |
CNY 3080.00 |
|
| LY427694 | Transient overexpression lysate of nei like 2 (E. coli) (NEIL2), transcript variant 4 |
CNY 3080.00 |
|
| PH300913 | NEIL2 MS Standard C13 and N15-labeled recombinant protein (NP_659480) |
CNY 19520.00 |
|
| PH327701 | NEIL2 MS Standard C13 and N15-labeled recombinant protein (NP_001129218) |
CNY 19520.00 |
|
| TP327701 | Recombinant protein of human nei like 2 (E. coli) (NEIL2), transcript variant 2, 20 µg |
CNY 2900.00 |
