CD70 (NM_001252) Human Recombinant Protein
CAT#: TP300410
Recombinant protein of human CD70 molecule (CD70), 20 µg
View other "CD70" proteins (6)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200410 protein sequence
Red=Cloning site Green=Tags(s) MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQD PRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSI SLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 20.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | In vitro binding assay (PMID: 25730144) |
| Reference Data | |
| RefSeq | NP_001243 |
| Locus ID | 970 |
| UniProt ID | P32970 |
| Refseq Size | 913 |
| Cytogenetics | 19p13.3 |
| Refseq ORF | 579 |
| Synonyms | CD27-L; CD27L; CD27LG; LPFS3; TNFSF7; TNLG8A |
| Summary | The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF27/CD27. It is a surface antigen on activated, but not on resting, T and B lymphocytes. It induces proliferation of costimulated T cells, enhances the generation of cytolytic T cells, and contributes to T cell activation. This cytokine is also reported to play a role in regulating B-cell activation, cytotoxic function of natural killer cells, and immunoglobulin sythesis. [provided by RefSeq, Jul 2008] |
| Protein Families | ES Cell Differentiation/IPS, Transmembrane |
| Protein Pathways | Cytokine-cytokine receptor interaction |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Insights into the molecular basis of a bispecific antibody's target selectivity
,Mazor, Y;Hansen, A;Yang, C;Chowdhury, PS;Wang, J;Stephens, G;Wu, H;Dall'Acqua, WF;,
MAbs
,PubMed ID 25730144
[CD70]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400501 | CD70 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400501 | Transient overexpression lysate of CD70 molecule (CD70) |
CNY 3080.00 |
|
| PH300410 | CD70 MS Standard C13 and N15-labeled recombinant protein (NP_001243) |
CNY 19520.00 |
|
| TP700287 | Purified recombinant protein of human CD70 molecule (CD70), with C-terminal Fc tag, expressed in human cells, 20 µg |
CNY 6650.00 |
|
| TP723962 | Human CD70 Protein, mFc-His Tag |
CNY 5249.00 |
|
| TP724019 | Human CD70 Protein, hFc-His Tag |
CNY 5249.00 |


