NME6 (NM_005793) Human Recombinant Protein
CAT#: TP300541
Recombinant protein of human non-metastatic cells 6, protein expressed in (nucleoside-diphosphate kinase) (NME6), 20 µg
View other "NME6" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200541 protein sequence
Red=Cloning site Green=Tags(s) MTQNLGSEMASILRSPQALQLTLALIKPDAVAHPLILEAVHQQILSNKFLIVRMRELLWRKEDCQRFYRE HEGRFFYQRLVEFMASGPIRAYILAHKDAIQLWRTLMGPTRVFRARHVAPDSIRGSFGLTDTRNTTHGSD SVVSASREIAAFFPDFSEQRWYEEEEPQLRCGPVCYSPEGGVHYVAGTGGLGPA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005784 |
Locus ID | 10201 |
UniProt ID | O75414 |
Refseq Size | 1189 |
Cytogenetics | 3p21.31 |
Refseq ORF | 582 |
Synonyms | IPIA-ALPHA; NDK 6; NM23-H6 |
Summary | Nucleoside diphosphate (NDP) kinases (EC 2.7.4.6), such as NME6, are ubiquitous enzymes that catalyze transfer of gamma-phosphates, via a phosphohistidine intermediate, between nucleoside and dioxynucleoside tri- and diphosphates (Mehus et al., 1999 [PubMed 10453732]).[supplied by OMIM, Jul 2010] |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Purine metabolism, Pyrimidine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417079 | NME6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417079 | Transient overexpression lysate of non-metastatic cells 6, protein expressed in (nucleoside-diphosphate kinase) (NME6) |
CNY 3080.00 |
|
PH300541 | NME6 MS Standard C13 and N15-labeled recombinant protein (NP_005784) |
CNY 19520.00 |