Cortactin (CTTN) (NM_138565) Human Recombinant Protein
CAT＃: TP301111
Recombinant protein of human cortactin (CTTN), transcript variant 2, 20 µg
View other "Cortactin" proteins (8)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 5 publications. |
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201111 protein sequence
Red=Cloning site Green=Tags(s) MWKASAGHAVSIAQDDAGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRENVFQEHQTLK EKELETGPKASHGYGGKFGVEQDRMDKSAVGHEYQSKLSKHCSQVDSVRGFGGKFGVQMDRVDQSAVGFE YQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQGKTEKHESQRDYSKGFGGKYGIDKDKVDKSA VGFEYQGKTEKHESQKDYVKGFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYSKGFGGKYGVQKDRM DKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEA RRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVYEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREAS SQQGLAYATEAVYESAEAPGHYPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDD GWWRGVCKGRYGLFPANYVELRQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 57.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | ELISA capture for autoantibodies (PMID: 27379450) ELISA capture for autoantibodies (PMID: 29068555) |
| Reference Data | |
| RefSeq | NP_612632 |
| Locus ID | 2017 |
| UniProt ID | Q14247 |
| Refseq Size | 3208 |
| Cytogenetics | 11q13.3 |
| Refseq ORF | 1539 |
| Synonyms | EMS1 |
| Summary | This gene is overexpressed in breast cancer and squamous cell carcinomas of the head and neck. The encoded protein is localized in the cytoplasm and in areas of the cell-substratum contacts. This gene has two roles: (1) regulating the interactions between components of adherens-type junctions and (2) organizing the cytoskeleton and cell adhesion structures of epithelia and carcinoma cells. During apoptosis, the encoded protein is degraded in a caspase-dependent manner. The aberrant regulation of this gene contributes to tumor cell invasion and metastasis. Three splice variants that encode different isoforms have been identified for this gene. [provided by RefSeq, May 2010] |
| Protein Families | Druggable Genome |
| Protein Pathways | Pathogenic Escherichia coli infection, Tight junction |
Citations (5)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Assessment of the breadth of binding promiscuity of heme towards human proteins.
,null,
Biological chemistry
,PubMed ID 36254402
[Cortactin]
|
|
Diagnostic utility of cortactin antibodies in myasthenia gravis
,Illa, I;Cortés-Vicente, E;Martínez, MÁ;Gallardo, E;,
Ann. N. Y. Acad. Sci.2017
,PubMed ID 29068555
[Cortactin]
|
|
Clinical Characteristics of Patients With Double-Seronegative Myasthenia Gravis and Antibodies to Cortactin
,Cortés-Vicente, E;Gallardo, E;Martínez, MÁ;Díaz-Manera, J;Querol, L;Rojas-García, R;Illa, I;,
JAMA Neurol
,PubMed ID 27379450
[Cortactin]
|
|
Cortactin autoantibodies in myasthenia gravis
,Gallardo, E;Martínez-Hernández, E;Titulaer, MJ;Huijbers, MG;Martínez, MA;Ramos, A;Querol, L;Díaz-Manera, J;Rojas-García, R;Hayworth, CR;Verschuuren, JJ;Balice-Gordon, R;Dalmau, J;Illa, I;,
Autoimmun Rev
,PubMed ID 25193850
[Cortactin]
|
|
Identification of a novel myositis-associated antibody directed against cortactin
,Labrador-Horrillo, M;Martínez, MA;,
Autoimmunity Reviews
[Cortactin]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403359 | CTTN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC417430 | CTTN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC429248 | CTTN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403359 | Transient overexpression lysate of cortactin (CTTN), transcript variant 2 |
CNY 3080.00 |
|
| LY417430 | Transient overexpression lysate of cortactin (CTTN), transcript variant 1 |
CNY 4840.00 |
|
| LY429248 | Transient overexpression lysate of cortactin (CTTN), transcript variant 1 |
CNY 3080.00 |
|
| PH301111 | CTTN MS Standard C13 and N15-labeled recombinant protein (NP_612632) |
CNY 19520.00 |
|
| TP710315 | Purified recombinant protein of Human cortactin (CTTN / EMS1), transcript variant 2, full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4020.00 |
其它Cortactin产品
