RAIDD (CRADD) (NM_003805) Human Recombinant Protein
CAT#: TP302050
Recombinant protein of human CASP2 and RIPK1 domain containing adaptor with death domain (CRADD), 20 µg
View other "RAIDD" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202050 protein sequence
Red=Cloning site Green=Tags(s) MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEINAQTTGLRKTMLLLDILPSRGPKAFD TFLDSLQEFPWVREKLKKAREEAMTDLPAGDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVLSLGL SQTDIYRCKANHPHNVQSQVVEAFIRWRQRFGKQATFQSLHNGLRAVEVDPSLLLHMLE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003796 |
Locus ID | 8738 |
UniProt ID | P78560 |
Refseq Size | 1201 |
Cytogenetics | 12q22 |
Refseq ORF | 597 |
Synonyms | MRT34; RAIDD |
Summary | This gene encodes a protein containing a death domain (DD) motif. This protein recruits caspase 2/ICH1 to the cell death signal transduction complex, which includes tumor necrosis factor receptor 1 (TNFR1A) and RIPK1/RIP kinase, and acts in promoting apoptosis. A mutation in this gene was associated with cognitive disability. A related pseudogene is found on chromosome 3. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016] |
Protein Families | Druggable Genome |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Receptor-interacting Ser/Thr kinase 1 (RIPK1) and myosin IIA-dependent ceramidosomes form membrane pores that mediate blebbing and necroptosis
,Nganga, R;Oleinik, N;Kim, J;Panneer Selvam, S;De Palma, R;Johnson, KA;Parikh, RY;Gangaraju, V;Peterson, Y;Dany, M;Stahelin, RV;Voelkel-Johnson, C;Szulc, ZM;Bieberich, E;Ogretmen, B;,
J. Biol. Chem.
,PubMed ID 30420430
[CRADD]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401252 | CRADD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401252 | Transient overexpression lysate of CASP2 and RIPK1 domain containing adaptor with death domain (CRADD) |
CNY 3080.00 |
|
PH302050 | CRADD MS Standard C13 and N15-labeled recombinant protein (NP_003796) |
CNY 19520.00 |
|
TP720921 | Purified recombinant protein of Human CASP2 and RIPK1 domain containing adaptor with death domain (CRADD) |
CNY 1800.00 |