GRK6 (NM_001004106) Human Recombinant Protein
CAT#: TP302464
Recombinant protein of human G protein-coupled receptor kinase 6 (GRK6), transcript variant 1, 20 µg
View other "GRK6" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202464 representing NM_001004106
Red=Cloning site Green=Tags(s) MELENIVANTVLLKAREGGGGNRKGKSKKWRQMLQFPHISQCEELRLSLERDYHSLCERQPIGRLLFREF CATRPELSRCVAFLDGVAEYEVTPDDKRKACGRQLTQNFLSHTGPDLIPEVPRQLVTNCTQRLEQGPCKD LFQELTRLTHEYLSVAPFADYLDSIYFNRFLQWKWLERQPVTKNTFRQYRVLGKGGFGEVCACQVRATGK MYACKKLEKKRIKKRKGEAMALNEKQILEKVNSRFVVSLAYAYETKDALCLVLTLMNGGDLKFHIYHMGQ AGFPEARAVFYAAEICCGLEDLHRERIVYRDLKPENILLDDHGHIRISDLGLAVHVPEGQTIKGRVGTVG YMAPEVVKNERYTFSPDWWALGCLLYEMIAGQSPFQQRKKKIKREEVERLVKEVPEEYSERFSPQARSLC SQLLCKDPAERLGCRGGSAREVKEHPLFKKLNFKRLGAGMLEPPFKPDPQAIYCKDVLDIEQFSTVKGVE LEPTDQDFYQKFATGSVPIPWQNEMVETECFQELNVFGLDGSVPPDLDWKGQPPAPPKKGLLQRLFSRQD CCGNCSDSEEELPTRL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 65.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001004106 |
| Locus ID | 2870 |
| UniProt ID | P43250 |
| Refseq Size | 2930 |
| Cytogenetics | 5q35.3 |
| Refseq ORF | 1728 |
| Synonyms | GPRK6 |
| Summary | This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. Several transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Protein Kinase |
| Protein Pathways | Chemokine signaling pathway, Endocytosis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419550 | GRK6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC424064 | GRK6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419550 | Transient overexpression lysate of G protein-coupled receptor kinase 6 (GRK6), transcript variant 2 |
CNY 4840.00 |
|
| LY424064 | Transient overexpression lysate of G protein-coupled receptor kinase 6 (GRK6), transcript variant 1 |
CNY 3080.00 |
|
| PH302464 | GRK6 MS Standard C13 and N15-labeled recombinant protein (NP_001004106) |
CNY 19520.00 |
