SIKE1 (NM_025073) Human Recombinant Protein
CAT#: TP303262
Recombinant protein of human suppressor of IKK epsilon (SIKE), transcript variant 2, 20 µg
View other "SIKE1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC203262 protein sequence
Red=Cloning site Green=Tags(s) MSCTIEKILTDAKTLLERLREHDAAAESLVDQSAALHRRVAAMREAGTALPDQYQEDASDMKDMSKYKPH ILLSQENTQIRDLQQENRELWISLEEHQDALELIMSKYRKQMLQLMVAKKAVDAEPVLKAHQSHSAEIES QIDRICEMGEVMRKAVQVDDDQFCKIQEKLAQLELENKELRELLSISSESLQARKENSMDTASQAIK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 23.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_079349 |
| Locus ID | 80143 |
| UniProt ID | Q9BRV8 |
| Refseq Size | 5507 |
| Cytogenetics | 1p13.2 |
| Refseq ORF | 621 |
| Synonyms | SIKE |
| Summary | SIKE interacts with IKK-epsilon (IKBKE; MIM 605048) and TBK1 (MIM 604834) and acts as a suppressor of TLR3 (MIM 603029) and virus-triggered interferon activation pathways (Huang et al., 2005 [PubMed 16281057]).[supplied by OMIM, Mar 2008] |
| Protein Pathways | RIG-I-like receptor signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410899 | SIKE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410899 | Transient overexpression lysate of suppressor of IKBKE 1 (SIKE1), transcript variant 2 |
CNY 3080.00 |
|
| PH303262 | SIKE1 MS Standard C13 and N15-labeled recombinant protein (NP_079349) |
CNY 19520.00 |

