RAP2B (NM_002886) Human Recombinant Protein
CAT#: TP304287
Recombinant protein of human RAP2B, member of RAS oncogene family (RAP2B), 20 µg
View other "RAP2B" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204287 protein sequence
Red=Cloning site Green=Tags(s) MREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDL YIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYERVPMILVGNKVDLEGEREVSYGEGKALAEEWSC PFMETSAKNKASVDELFAEIVRQMNYAAQPNGDEGCCSACVIL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002877 |
Locus ID | 5912 |
UniProt ID | P61225 |
Refseq Size | 8413 |
Cytogenetics | 3q25.2 |
Refseq ORF | 549 |
Summary | This intronless gene belongs to a family of RAS-related genes. The proteins encoded by these genes share approximately 50% amino acid identity with the classical RAS proteins and have numerous structural features in common. The most striking difference between the RAP and RAS proteins resides in their 61st amino acid: glutamine in RAS is replaced by threonine in RAP proteins. Evidence suggests that this protein may be polyisoprenylated and palmitoylated. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419033 | RAP2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419033 | Transient overexpression lysate of RAP2B, member of RAS oncogene family (RAP2B) |
CNY 3080.00 |
|
PH304287 | RAP2B MS Standard C13 and N15-labeled recombinant protein (NP_002877) |
CNY 19520.00 |