Protein phosphatase inhibitor 1 (PPP1R1A) (NM_006741) Human Recombinant Protein
CAT#: TP305263
Recombinant protein of human protein phosphatase 1, regulatory (inhibitor) subunit 1A (PPP1R1A), 20 µg
View other "Protein phosphatase inhibitor 1" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC205263 protein sequence
Red=Cloning site Green=Tags(s) MEQDNSPQKIQFTVPLLEPHLDPEAAEQIRRRRPTPATLVLTSDQSSPEIDEDRIPNPHLKSTLAMSPRQ RKKMTRITPTMKELQMMVEHHLGQQQQGEEPEGAAESTGTQESRPPGIPDTEVESRLGTSGTAKKTAECI PKTHERGSKEPSTKEPSTHIPPLDSKGANSV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 18.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_006732 |
| Locus ID | 5502 |
| UniProt ID | Q13522 |
| Refseq Size | 1849 |
| Cytogenetics | 12q13.2 |
| Refseq ORF | 513 |
| Synonyms | I1; IPP1 |
| Summary | Inhibitor of protein-phosphatase 1. This protein may be important in hormonal control of glycogen metabolism. Hormones that elevate intracellular cAMP increase I-1 activity in many tissues. I-1 activation may impose cAMP control over proteins that are not directly phosphorylated by PKA. Following a rise in intracellular calcium, I-1 is inactivated by calcineurin (or PP2B). Does not inhibit type-2 phosphatases.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome |
| Protein Pathways | Long-term potentiation |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402013 | PPP1R1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402013 | Transient overexpression lysate of protein phosphatase 1, regulatory (inhibitor) subunit 1A (PPP1R1A) |
CNY 3080.00 |
|
| PH305263 | PPP1R1A MS Standard C13 and N15-labeled recombinant protein (NP_006732) |
CNY 19520.00 |
|
| TP720141 | Recombinant protein of human protein phosphatase 1, regulatory (inhibitor) subunit 1A (PPP1R1A) |
CNY 1800.00 |
其它Protein phosphatase inhibitor 1产品
