TLX3 (NM_021025) Human Recombinant Protein
CAT#: TP305739
Recombinant protein of human T-cell leukemia homeobox 3 (TLX3), 20 µg
View other "TLX3" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205739 protein sequence
Red=Cloning site Green=Tags(s) MEAPASAQTPHPHEPISFGIDQILNSPDQDSAPAPRGPDGASYLGGPPGGRPGATYPSLPASFAGLGAPF EDAGSYSVNLSLAPAGVIRVPAHRPLPGAVPPPLPSALPAMPSVPTVSSLGGLNFPWMESSRRFVKDRFT AAAALTPFTVTRRIGHPYQNRTPPKRKKPRTSFSRVQICELEKRFHRQKYLASAERAALAKSLKMTDAQV KTWFQNRRTKWRRQTAEEREAERQQASRLMLQLQHDAFQKSLNDSIQPDPLCLHNSSLFALQNLQPWEED SSKVPAVTSLV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 31.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_066305 |
Locus ID | 30012 |
UniProt ID | O43711 |
Refseq Size | 1513 |
Cytogenetics | 5q35.1 |
Refseq ORF | 873 |
Synonyms | HOX11L2; RNX |
Summary | The protein encoded by this gene is an orphan homeobox protein that encodes a DNA-binding nuclear transcription factor. A translocation [t(5;14)(q35;q32)] involving this gene is associated with T-cell acute lymphoblastic leukemia (T-ALL) in children and young adults. [provided by RefSeq, Nov 2015] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412148 | TLX3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412148 | Transient overexpression lysate of T-cell leukemia homeobox 3 (TLX3) |
CNY 3080.00 |
|
PH305739 | TLX3 MS Standard C13 and N15-labeled recombinant protein (NP_066305) |
CNY 14250.00 |