liver FABP (FABP1) (NM_001443) Human Recombinant Protein
CAT#: TP307592
Recombinant protein of human fatty acid binding protein 1, liver (FABP1), 20 µg
View other "liver FABP" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207592 protein sequence
Red=Cloning site Green=Tags(s) MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECE LETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 14 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001434 |
Locus ID | 2168 |
UniProt ID | P07148 |
Refseq Size | 598 |
Cytogenetics | 2p11.2 |
Refseq ORF | 381 |
Synonyms | FABPL; L-FABP |
Summary | This gene encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. This protein and FABP6 (the ileal fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. [provided by RefSeq, Mar 2011] |
Protein Pathways | PPAR signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400559 | FABP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400559 | Transient overexpression lysate of fatty acid binding protein 1, liver (FABP1) |
CNY 3080.00 |
|
PH307592 | FABP1 MS Standard C13 and N15-labeled recombinant protein (NP_001434) |
CNY 19520.00 |
|
TP720114 | Recombinant protein of human fatty acid binding protein 1, liver (FABP1) |
CNY 1800.00 |
其它liver FABP产品