HE4 (WFDC2) (NM_006103) Human Recombinant Protein
CAT#: TP308491
Recombinant protein of human WAP four-disulfide core domain 2 (WFDC2), 20 µg
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 2900.00
| Cited in 1 publication. | 
                                                
                                                
                                                
                                                    CNY 1999.00 
                                                    
                                                    CNY 2700.00
                                                
                                            
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >RC208491 protein sequence 
Red=Cloning site Green=Tags(s) MPACRLGPLAAALLLSLLLFGFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFC SLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Predicted MW | 10 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_006094 | 
| Locus ID | 10406 | 
| UniProt ID | Q14508 | 
| Refseq Size | 570 | 
| Cytogenetics | 20q13.12 | 
| Refseq ORF | 372 | 
| Synonyms | dJ461P17.6; EDDM4; HE4; WAP5 | 
| Summary | This gene encodes a protein that is a member of the WFDC domain family. The WFDC domain, or WAP Signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. This gene is expressed in pulmonary epithelial cells, and was also found to be expressed in some ovarian cancers. The encoded protein is a small secretory protein, which may be involved in sperm maturation. [provided by RefSeq, Jul 2008] | 
| Protein Families | Secreted Protein, Transmembrane | 
Citations (1)
| The use of this Proteins has been cited in the following citations: | 
|---|
| 
                                                HE4 expression is associated with hormonal elements and mediated by importin-dependent nuclear translocation
                                                ,null,
                                                Scientific Reports
                                                ,PubMed ID 24975515
                                                [WFDC2]
                                                 | 
                                        
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC416866 | WFDC2 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY416866 | Transient overexpression lysate of WAP four-disulfide core domain 2 (WFDC2) | 
                                                     CNY 3080.00  | 
                                            |
| PH308491 | WFDC2 MS Standard C13 and N15-labeled recombinant protein (NP_006094) | 
                                                     CNY 19520.00  | 
                                            |
| TP750124 | Purified recombinant protein of Human WAP four-disulfide core domain 2 (HE4), N-terminal Trx-HIS tag, expressed in E. coli, 50ug | 
                                                     CNY 2000.00  | 
                                            
