CA13 (NM_198584) Human Recombinant Protein
CAT#: TP308607
Recombinant protein of human carbonic anhydrase XIII (CA13), 20 µg
View other "CA13" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208607 protein sequence
Red=Cloning site Green=Tags(s) MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVD FDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPD GLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTW IVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 29.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_940986 |
Locus ID | 377677 |
UniProt ID | Q8N1Q1 |
Refseq Size | 3855 |
Cytogenetics | 8q21.2 |
Refseq ORF | 786 |
Synonyms | CAXIII |
Summary | Carbonic anhydrases (CAs) are a family of zinc metalloenzymes. For background information on the CA family, see MIM 114800.[supplied by OMIM, Mar 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Nitrogen metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404835 | CA13 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404835 | Transient overexpression lysate of carbonic anhydrase XIII (CA13) |
CNY 3080.00 |
|
PH308607 | CA13 MS Standard C13 and N15-labeled recombinant protein (NP_940986) |
CNY 19520.00 |
|
TP720089 | Recombinant protein of human carbonic anhydrase XIII (CA13) |
CNY 1800.00 |