CA13 (NM_198584) Human Recombinant Protein
CAT#: TP308607L
Recombinant protein of human carbonic anhydrase XIII (CA13), 1 mg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 36000.00
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC208607 protein sequence
Red=Cloning site Green=Tags(s) MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVD FDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPD GLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTW IVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 29.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_940986 |
| Locus ID | 377677 |
| UniProt ID | Q8N1Q1 |
| Refseq Size | 3855 |
| Cytogenetics | 8q21.2 |
| Refseq ORF | 786 |
| Synonyms | CAXIII |
| Summary | Carbonic anhydrases (CAs) are a family of zinc metalloenzymes. For background information on the CA family, see MIM 114800.[supplied by OMIM, Mar 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Nitrogen metabolism |
Documents
| FAQs |
| SDS |
