GSK3 alpha (GSK3A) (NM_019884) Human Recombinant Protein
CAT#: TP308698
Recombinant protein of human glycogen synthase kinase 3 alpha (GSK3A), 20 µg
View other "GSK3 alpha" proteins (3)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 2900.00
| Cited in 1 publication. | 
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >RC208698 protein sequence 
Red=Cloning site Green=Tags(s) MSGGGPSGGGPGGSGRARTSSFAEPGGGGGGGGGGPGGSASGPGGTGGGKASVGAMGGGVGASSSGGGPG GSGGGGSGGPGAGTSFPPPGVKLGRDSGKVTTVVATLGQGPERSQEVAYTDIKVIGNGSFGVVYQARLAE TRELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDELYLNLVLEYVPETVYRVARHFT KAKLTIPILYVKVYMYQLFRSLAYIHSQGVCHRDIKPQNLLVDPDTAVLKLCDFGSAKQLVRGEPNVSYI CSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPN YTEFKFPQIKAHPWTKVFKSRTPPEAIALCSSLLEYTPSSRLSPLEACAHSFFDELRCLGTQLPNNRPLP PLFNFSAGELSIQPSLNAILIPPHLRSPAGTTTLTPSSQALTETPTSSDWQSTDATPTLTNSS myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Predicted MW | 50.8 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Bioactivity | In vitro kinase assay (enzyme) (PMID: 26618561) Thermophoresis assay (PMID: 26618561)  | 
        
| Reference Data | |
| RefSeq | NP_063937 | 
| Locus ID | 2931 | 
| UniProt ID | P49840 | 
| Refseq Size | 2200 | 
| Cytogenetics | 19q13.2 | 
| Refseq ORF | 1449 | 
| Summary | This gene encodes a multifunctional Ser/Thr protein kinase that is implicated in the control of several regulatory proteins including glycogen synthase, and transcription factors, such as JUN. It also plays a role in the WNT and PI3K signaling pathways, as well as regulates the production of beta-amyloid peptides associated with Alzheimer's disease. [provided by RefSeq, Oct 2011] | 
| Protein Families | Druggable Genome, Protein Kinase | 
| Protein Pathways | Chemokine signaling pathway | 
Citations (1)
| The use of this Proteins has been cited in the following citations: | 
|---|
| 
                                                Direct High Affinity Interaction between Aß42 and GSK3a Stimulates Hyperphosphorylation of Tau. A New Molecular Link in Alzheimer's Disease?
                                                ,Dunning, CJ;McGauran, G;Willén, K;Gouras, GK;O'Connell, DJ;Linse, S;,
                                                ACS Chem Neurosci
                                                ,PubMed ID 26618561
                                                [GSK3A]
                                                 | 
                                        
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC412674 | GSK3A HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY412674 | Transient overexpression lysate of glycogen synthase kinase 3 alpha (GSK3A) | 
                                                     CNY 3080.00  | 
                                            |
| PH308698 | GSK3A MS Standard C13 and N15-labeled recombinant protein (NP_063937) | 
                                                     CNY 19520.00  | 
                                            
其它GSK3 alpha产品
