THEM5 (NM_182578) Human Recombinant Protein
CAT#: TP310954
Recombinant protein of human thioesterase superfamily member 5 (THEM5), 20 µg
View other "THEM5" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC210954 protein sequence
Red=Cloning site Green=Tags(s) MIRRCFQVAARLGHHRGLLEAPRILPRLNPASAFGSSTDSMFSRFLPEKTDLKDYALPNASWCSDMLSLY QEFLEKTKSSGWIKLPSFKSNRDHIRGLKLPSGLAVSSDKGDCRIFTRCIQVEGQGFEYVIFFQPTQKKS VCLFQPGSYLEGPPGFAHGGSLAAMMDETFSKTAFLAGEGLFTLSLNIRFKNLIPVDSLVVMDVEVDKIE DQKLYMSCIAHSRDQQTVYAKSSGVFLQLQLEEESPQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 27.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_872384 |
| Locus ID | 284486 |
| UniProt ID | Q8N1Q8 |
| Refseq Size | 1146 |
| Cytogenetics | 1q21.3 |
| Refseq ORF | 741 |
| Synonyms | ACOT15 |
| Summary | Has acyl-CoA thioesterase activity towards long-chain (C16 and C18) fatty acyl-CoA substrates, with a preference for linoleoyl-CoA and other unsaturated long-chain fatty acid-CoA esters (PubMed:22586271). Plays an important role in mitochondrial fatty acid metabolism, and in remodeling of the mitochondrial lipid cardiolipin (PubMed:22586271). Required for normal mitochondrial function (PubMed:22586271).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405467 | THEM5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405467 | Transient overexpression lysate of thioesterase superfamily member 5 (THEM5) |
CNY 3080.00 |
|
| PH310954 | THEM5 MS Standard C13 and N15-labeled recombinant protein (NP_872384) |
CNY 19520.00 |
