Protor 1 (PRR5) (NM_015366) Human Recombinant Protein
CAT＃: TP317823
Recombinant protein of human proline rich 5 (renal) (PRR5), transcript variant 2, 20 µg
View other "Protor 1" proteins (9)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC217823 representing NM_015366
Red=Cloning site Green=Tags(s) MSSPSLSDLGKREPAAAADERGTQQRRACANATWNSIHNGVIAVFQRKGLPDQELFSLNEGVRQLLKTEL GSFFTEYLQNQLLTKGMVILRDKIRFYEGQKLLDSLAETWDFFFSDVLPMLQAIFYPVQGKEPSVRQLAL LHFRNAITLSVKLEDALARAHARVPPAIVQMLLVLQGVHESRGVTEDYLRLETLVQKVVSPYLGTYGLHS SEGPFTHSCILEKRLLRRSRSGDVLAKNPVVRSKSYNTPLLNPVQEHEAEGAAAGGTSIRRHSVSEMTSC PEPQGFSDPPGQGPTGTFRSSPAPHSGPCPSRLYPTTQPPEQGLDPTRSSLPRSSPENLVDQILESVDSD SEGIFIDFGRGRGSGMSDLEGSGGRQSVV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 41.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_056181 |
| Locus ID | 55615 |
| UniProt ID | P85299 |
| Refseq Size | 1653 |
| Cytogenetics | 22q13.31 |
| Refseq ORF | 1137 |
| Synonyms | FLJ20185k; PP610; PROTOR-1; PROTOR1 |
| Summary | This gene encodes a protein with a proline-rich domain. This gene is located in a region of chromosome 22 reported to contain a tumor suppressor gene that may be involved in breast and colorectal tumorigenesis. The protein is a component of the mammalian target of rapamycin complex 2 (mTORC2), and it regulates platelet-derived growth factor (PDGF) receptor beta expression and PDGF signaling to Akt and S6K1. Alternative splicing and the use of alternative promoters results in transcripts encoding different isoforms. Read-through transcripts from this gene into the downstream Rho GTPase activating protein 8 (ARHGAP8) gene also exist, which led to the original description of PRR5 and ARHGAP8 being a single gene. [provided by RefSeq, Nov 2010] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405788 | PRR5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC414595 | PRR5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC422741 | PRR5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422742 | PRR5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405788 | Transient overexpression lysate of proline rich 5 (renal) (PRR5), transcript variant 1 |
CNY 3080.00 |
|
| LY414595 | Transient overexpression lysate of proline rich 5 (renal) (PRR5), transcript variant 2 |
CNY 4840.00 |
|
| LY422741 | Transient overexpression lysate of proline rich 5 (renal) (PRR5), transcript variant 3 |
CNY 3080.00 |
|
| LY422742 | Transient overexpression lysate of proline rich 5 (renal) (PRR5), transcript variant 5 |
CNY 3080.00 |
|
| PH317823 | PRR5 MS Standard C13 and N15-labeled recombinant protein (NP_056181) |
CNY 19520.00 |
其它Protor 1产品
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
