HNF 4 alpha (HNF4A) (NM_000457) Human Recombinant Protein
CAT＃: TP317863
Recombinant protein of human hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 2, 20 µg
View other "HNF 4 alpha" proteins (17)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
| Cited in 3 publications. |
Product images
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC217863 representing NM_000457
Red=Cloning site Green=Tags(s) MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNAPNSLGVSALCAICGDRATGK HYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTR RSSYEDSSLPSINALLQAEVLSRQITSPVSGINGDIRAKKIASIADVCESMKEQLLVLVEWAKYIPAFCE LPLDDQVALLRAHAGEHLLLGATKRSMVFKDVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQ IDDNEYAYLKAIIFFDPDAKGLSDPGKIKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQ MIEQIQFIKLFGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEW PRPRGQAATPETPQPSPPGGSGSEPYKLLPGAVATIVKPLSAIPQPTITKQEVI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 52.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | HNF4A Activity Verified in a DNA-binding Assay: HNF4A (TP317863, transcript variant 2) activity was measured in a colorimetric DNA-binding assay. Purified HNF4A protein containing a C-terminal MYC/DDK tag was incubated with biotinylated double-stranded oligonucleotide containing the HNF4A consensus DNA-binding sequence (see below). Following incubation, the reaction was transferred to a streptavidin-coated microplate to allow capture of the DNA-protein complex. After washing, the captured protein was detected with an anti-DDK peroxidase conjugate and colorimetric signal detection with TMB. Specificity of the protein-DNA interaction was confirmed by carrying out the binding in the presence of an unlabeled competitor oligonucleotide and by comparison to binding to an oligonucleotide containing a mutation in the consensus binding sequence. EMSA assay (PMID: 25598084) Binding assay (PMID: 29642240) |
| Reference Data | |
| RefSeq | NP_000448 |
| Locus ID | 3172 |
| UniProt ID | P41235 |
| Refseq Size | 4737 |
| Cytogenetics | 20q13.12 |
| Refseq ORF | 1422 |
| Synonyms | FRTS4; HNF4; HNF4a7; HNF4a8; HNF4a9; HNF4alpha; MODY; MODY1; NR2A1; NR2A21; TCF; TCF-14; TCF14 |
| Summary | The protein encoded by this gene is a nuclear transcription factor which binds DNA as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal dominant non-insulin-dependent diabetes mellitus type I. Alternative splicing of this gene results in multiple transcript variants encoding several different isoforms. [provided by RefSeq, Apr 2012] |
| Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Nuclear Hormone Receptor, Transcription Factors |
| Protein Pathways | Maturity onset diabetes of the young |
Citations (3)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Christmas disease in a Hovawart family resembling human hemophilia B Leyden is caused by a single nucleotide deletion in a highly conserved transcription factor binding site of the F9 gene promoter
,Brenig, B;Steingräber, L;Shan, S;Xu, F;Hirschfeld, M;Andag, R;Spengeler, M;Dietschi, E;Mischke, R;Leeb, T;,
Haematologica
,PubMed ID 30846504
[HNF4A]
|
|
Sodium bicarbonate cotransporter NBCe2 gene variants increase sodium and bicarbonate transport in human renal proximal tubule cells
,Gildea, JJ;Xu, P;Kemp, BA;Carlson, JM;Tran, HT;Bigler Wang, D;Langouët-Astrié, CJ;McGrath, HE;Carey, RM;Jose, PA;Felder, RA;,
PLoS ONE
,PubMed ID 29642240
[HNF4A]
|
|
Hepatocyte nuclear factor (HNF) 4a transactivation of cytochrome P450 (Cyp) 2d40 promoter is enhanced during pregnancy in mice
,Ning, M;Koh, KH;Pan, X;Jeong, H;,
Biochem. Pharmacol.
,PubMed ID 25598084
[HNF4A]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400161 | HNF4A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC405861 | HNF4A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC422283 | HNF4A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC422284 | HNF4A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400161 | Transient overexpression lysate of hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 2 |
CNY 4840.00 |
|
| LY405861 | Transient overexpression lysate of hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 3 |
CNY 4840.00 |
|
| LY422283 | Transient overexpression lysate of hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 5 |
CNY 4840.00 |
|
| LY422284 | Transient overexpression lysate of hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 6 |
CNY 3080.00 |
|
| PH311443 | HNF4A MS Standard C13 and N15-labeled recombinant protein (NP_001025174) |
CNY 19520.00 |
|
| PH314914 | HNF4A MS Standard C13 and N15-labeled recombinant protein (NP_849180) |
CNY 19520.00 |
|
| PH316588 | HNF4A MS Standard C13 and N15-labeled recombinant protein (NP_001025175) |
CNY 19520.00 |
|
| PH317863 | HNF4A MS Standard C13 and N15-labeled recombinant protein (NP_000448) |
CNY 19520.00 |
|
| PH317924 | HNF4A MS Standard C13 and N15-labeled recombinant protein (NP_849181) |
CNY 19520.00 |
|
| TP311443 | Recombinant protein of human hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 5, 20 µg |
CNY 2900.00 |
|
| TP314914 | Recombinant protein of human hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP316588 | Recombinant protein of human hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 6, 20 µg |
CNY 2900.00 |
|
| TP317924 | Recombinant protein of human hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 3, 20 µg |
CNY 2900.00 |
其它HNF 4 alpha产品
