RANKL (TNFSF11) (NM_003701) Human Recombinant Protein
CAT#: TP318782
Purified recombinant protein of Homo sapiens tumor necrosis factor (ligand) superfamily, member 11 (TNFSF11), transcript variant 1, 20 µg
View other "RANKL" proteins (8)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC218782 representing NM_003701
Red=Cloning site Green=Tags(s) MRRASRDYTKYLRGSEEMGGGPGAPHEGPLHAPPPPAPHQPPAASRSMFVALLGLGLGQVVCSVALFFYF RAQMDPNRISEDGTHCIYRILRLHENADFQDTTLESQDTKLIPDSCRRIKQAFQGAVQKELQHIVGSQHI RAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQ DGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGF FKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 35.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003692 |
Locus ID | 8600 |
UniProt ID | O14788 |
Refseq Size | 2226 |
Cytogenetics | 13q14.11 |
Refseq ORF | 951 |
Synonyms | CD254; hRANKL2; ODF; OPGL; OPTB2; RANKL; sOdf; TNLG6B; TRANCE |
Summary | This gene encodes a member of the tumor necrosis factor (TNF) cytokine family which is a ligand for osteoprotegerin and functions as a key factor for osteoclast differentiation and activation. This protein was shown to be a dentritic cell survival factor and is involved in the regulation of T cell-dependent immune response. T cell activation was reported to induce expression of this gene and lead to an increase of osteoclastogenesis and bone loss. This protein was shown to activate antiapoptotic kinase AKT/PKB through a signaling complex involving SRC kinase and tumor necrosis factor receptor-associated factor (TRAF) 6, which indicated this protein may have a role in the regulation of cell apoptosis. Targeted disruption of the related gene in mice led to severe osteopetrosis and a lack of osteoclasts. The deficient mice exhibited defects in early differentiation of T and B lymphocytes, and failed to form lobulo-alveolar mammary structures during pregnancy. Two alternatively spliced transcript variants have been found. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Cytokine-cytokine receptor interaction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401221 | TNFSF11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC403220 | TNFSF11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401221 | Transient overexpression lysate of tumor necrosis factor (ligand) superfamily, member 11 (TNFSF11), transcript variant 1 |
CNY 3080.00 |
|
LY403220 | Transient overexpression lysate of tumor necrosis factor (ligand) superfamily, member 11 (TNFSF11), transcript variant 2 |
CNY 3080.00 |
|
PH318782 | TNFSF11 MS Standard C13 and N15-labeled recombinant protein (NP_003692) |
CNY 14250.00 |
|
PH324778 | TNFSF11 MS Standard C13 and N15-labeled recombinant protein (NP_143026) |
CNY 19520.00 |
|
TP324778 | Recombinant protein of human tumor necrosis factor (ligand) superfamily, member 11 (TNFSF11), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP723867 | Purified recombinant protein of Human tumor necrosis factor (ligand) superfamily, member 11 (TNFSF11 / RANKL), transcript variant 1 |
CNY 5240.00 |