RAD54 (RAD54L) (NM_003579) Human Recombinant Protein
CAT#: TP320046
Recombinant protein of human RAD54-like (S. cerevisiae) (RAD54L), transcript variant 1, 20 µg
View other "RAD54" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC220046 protein sequence
Red=Cloning site Green=Tags(s) MRRSLAPSQLAKRKPEGRSCDDEDWQPGLVTPRKRKSSSETQIQECFLSPFRKPLSQLTNQPPCLDSSQH EAFIRSILSKPFKVPIPNYQGPLGSRALGLKRAGVRRALHDPLEKDALVLYEPPPLSAHDQLKLDKEKLP VHVVVDPILSKVLRPHQREGVKFLWECVTSRRIPGSHGCIMADEMGLGKTLQCITLMWTLLRQSPECKPE IDKAVVVSPSSLVKNWYNEVGKWLGGRIQPLAIDGGSKDEIDQKLEGFMNQRGARVSSPILIISYETFRL HVGVLQKGSVGLVICDEGHRLKNSENQTYQALDSLNTSRRVLISGTPIQNDLLEYFSLVHFVNSGILGTA HEFKKHFELPILKGRDAAASEADRQLGEERLRELTSIVNRCLIRRTSDILSKYLPVKIEQVVCCRLTPLQ TELYKRFLRQAKPAEELLEGKMSVSSLSSITSLKKLCNHPALIYDKCVEEEDGFVGALDLFPPGYSSKAL EPQLSGKMLVLDYILAVTRSRSSDKVVLVSNYTQTLDLFEKLCRARRYLYVRLDGTMSIKKRAKVVERFN SPSSPDFVFMLSSKAGGCGLNLIGANRLVMFDPDWNPANDEQAMARVWRDGQKKTCYIYRLLSAGTIEEK IFQRQSHKKALSSCVVDEEQDVERHFSLGELKELFILDEASLSDTHDRLHCRRCVNSRQIRPPPDGSDCT SDLAGWNHCTDKWGLRDEVLQAAWDAASTAITFVFHQRSHEEQRGLR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 84.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003570 |
Locus ID | 8438 |
UniProt ID | Q92698 |
Refseq Size | 3164 |
Cytogenetics | 1p34.1 |
Refseq ORF | 2241 |
Synonyms | hHR54; HR54; hRAD54; RAD54A |
Summary | The protein encoded by this gene belongs to the DEAD-like helicase superfamily, and shares similarity with Saccharomyces cerevisiae Rad54, a protein known to be involved in the homologous recombination and repair of DNA. This protein has been shown to play a role in homologous recombination related repair of DNA double-strand breaks. The binding of this protein to double-strand DNA induces a DNA topological change, which is thought to facilitate homologous DNA paring, and stimulate DNA recombination. Alternative splicing results in multiple transcript variants encoding the same protein.[provided by RefSeq, Dec 2008] |
Protein Families | Druggable Genome, Stem cell - Pluripotency |
Protein Pathways | Homologous recombination |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418575 | RAD54L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC428166 | RAD54L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY418575 | Transient overexpression lysate of RAD54-like (S. cerevisiae) (RAD54L), transcript variant 1 |
CNY 4840.00 |
|
LY428166 | Transient overexpression lysate of RAD54-like (S. cerevisiae) (RAD54L), transcript variant 2 |
CNY 4840.00 |
|
PH320046 | RAD54L MS Standard C13 and N15-labeled recombinant protein (NP_003570) |
CNY 19520.00 |
|
PH327119 | RAD54L MS Standard C13 and N15-labeled recombinant protein (NP_001136020) |
CNY 19520.00 |
|
TP327119 | Recombinant protein of human RAD54-like (S. cerevisiae) (RAD54L), transcript variant 2, 20 µg |
CNY 2900.00 |