RAD54 (RAD54L) (NM_001142548) Human Recombinant Protein
CAT#: TP327119
Recombinant protein of human RAD54-like (S. cerevisiae) (RAD54L), transcript variant 2, 20 µg
View other "RAD54" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC227119 protein sequence
Red=Cloning site Green=Tags(s) MRRSLAPSQLAKRKPEGRSCDDEDWQPGLVTPRKRKSSSETQIQECFLSPFRKPLSQLTNQPPCLDSSQH EAFIRSILSKPFKVPIPNYQGPLGSRALGLKRAGVRRALHDPLEKDALVLYEPPPLSAHDQLKLDKEKLP VHVVVDPILSKVLRPHQREGVKFLWECVTSRRIPGSHGCIMADEMGLGKTLQCITLMWTLLRQSPECKPE IDKAVVVSPSSLVKNWYNEVGKWLGGRIQPLAIDGGSKDEIDQKLEGFMNQRGARVSSPILIISYETFRL HVGVLQKGSVGLVICDEGHRLKNSENQTYQALDSLNTSRRVLISGTPIQNDLLEYFSLVHFVNSGILGTA HEFKKHFELPILKGRDAAASEADRQLGEERLRELTSIVNRCLIRRTSDILSKYLPVKIEQVVCCRLTPLQ TELYKRFLRQAKPAEELLEGKMSVSSLSSITSLKKLCNHPALIYDKCVEEEDGFVGALDLFPPGYSSKAL EPQLSGKMLVLDYILAVTRSRSSDKVVLVSNYTQTLDLFEKLCRARRYLYVRLDGTMSIKKRAKVVERFN SPSSPDFVFMLSSKAGGCGLNLIGANRLVMFDPDWNPANDEQAMARVWRDGQKKTCYIYRLLSAGTIEEK IFQRQSHKKALSSCVVDEEQDVERHFSLGELKELFILDEASLSDTHDRLHCRRCVNSRQIRPPPDGSDCT SDLAGWNHCTDKWGLRDEVLQAAWDAASTAITFVFHQRSHEEQRGLR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 84.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001136020 |
| Locus ID | 8438 |
| UniProt ID | Q92698 |
| Refseq Size | 2567 |
| Cytogenetics | 1p34.1 |
| Refseq ORF | 2241 |
| Synonyms | hHR54; HR54; hRAD54; RAD54A |
| Summary | The protein encoded by this gene belongs to the DEAD-like helicase superfamily, and shares similarity with Saccharomyces cerevisiae Rad54, a protein known to be involved in the homologous recombination and repair of DNA. This protein has been shown to play a role in homologous recombination related repair of DNA double-strand breaks. The binding of this protein to double-strand DNA induces a DNA topological change, which is thought to facilitate homologous DNA paring, and stimulate DNA recombination. Alternative splicing results in multiple transcript variants encoding the same protein.[provided by RefSeq, Dec 2008] |
| Protein Families | Druggable Genome, Stem cell - Pluripotency |
| Protein Pathways | Homologous recombination |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418575 | RAD54L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC428166 | RAD54L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY418575 | Transient overexpression lysate of RAD54-like (S. cerevisiae) (RAD54L), transcript variant 1 |
CNY 4840.00 |
|
| LY428166 | Transient overexpression lysate of RAD54-like (S. cerevisiae) (RAD54L), transcript variant 2 |
CNY 4840.00 |
|
| PH320046 | RAD54L MS Standard C13 and N15-labeled recombinant protein (NP_003570) |
CNY 19520.00 |
|
| PH327119 | RAD54L MS Standard C13 and N15-labeled recombinant protein (NP_001136020) |
CNY 19520.00 |
|
| TP320046 | Recombinant protein of human RAD54-like (S. cerevisiae) (RAD54L), transcript variant 1, 20 µg |
CNY 2900.00 |
