HOPX (NM_032495) Human Recombinant Protein
CAT#: TP322859
Recombinant protein of human HOP homeobox (HOPX), transcript variant 1, 20 µg
View other "HOPX" proteins (13)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC222859 protein sequence
Red=Cloning site Green=Tags(s) MSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRS VID myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 8.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_115884 |
Locus ID | 84525 |
UniProt ID | Q9BPY8 |
Refseq Size | 1552 |
Cytogenetics | 4q12 |
Refseq ORF | 219 |
Synonyms | CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31; TOTO |
Summary | The protein encoded by this gene is a homeodomain protein that lacks certain conserved residues required for DNA binding. It was reported that choriocarcinoma cell lines and tissues failed to express this gene, which suggested the possible involvement of this gene in malignant conversion of placental trophoblasts. Studies in mice suggest that this protein may interact with serum response factor (SRF) and modulate SRF-dependent cardiac-specific gene expression and cardiac development. Multiple alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq, Feb 2009] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408356 | HOPX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC408357 | HOPX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC410073 | HOPX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428902 | HOPX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408356 | Transient overexpression lysate of HOP homeobox (HOPX), transcript variant 2 |
CNY 3080.00 |
|
LY408357 | Transient overexpression lysate of HOP homeobox (HOPX), transcript variant 3 |
CNY 3080.00 |
|
LY410073 | Transient overexpression lysate of HOP homeobox (HOPX), transcript variant 1 |
CNY 3080.00 |
|
LY428902 | Transient overexpression lysate of HOP homeobox (HOPX), transcript variant 4 |
CNY 3080.00 |
|
PH304361 | HOPX MS Standard C13 and N15-labeled recombinant protein (NP_631957) |
CNY 14250.00 |
|
PH322859 | HOPX MS Standard C13 and N15-labeled recombinant protein (NP_115884) |
CNY 19520.00 |
|
PH322903 | HOPX MS Standard C13 and N15-labeled recombinant protein (NP_631958) |
CNY 14250.00 |
|
TP304361 | Purified recombinant protein of Homo sapiens HOP homeobox (HOPX), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP322903 | Purified recombinant protein of Homo sapiens HOP homeobox (HOPX), transcript variant 3, 20 µg |
CNY 2900.00 |