Prkra (NM_011871) Mouse Recombinant Protein
CAT#: TP504457
Purified recombinant protein of Mouse protein kinase, interferon inducible double stranded RNA dependent activator (Prkra), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR204457 protein sequence
Red=Cloning site Green=Tags(s) MSHSRHRAEAPPLQREDSGTFSLGKMITAKPGKTPIQVLHEYGMKTKNIPVYECERSDVQVHVPTFTFRV TVGDITCTGEGTSKKLAKHRAAEAAINILKANASICFAVPDPLMPDPSKQPKNQLNPIGSLQELAIHHGW RLPEYTLSQEGGPAHKREYTTICRLESFMETGKGASKKQAKRNAAEKFLAKFSNISPENHISLTNVVGHS LGCTWHSLRNSPGEKINLLKRSLLSLPNTDYIQLLSEIASEQGFNITYLDIEELSANGQYQCLAELSTSP ITVCHGSGISCGNAQSDAAHNALQYLKIIAERK myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 34.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_036001 |
| Locus ID | 23992 |
| UniProt ID | Q9WTX2 |
| Refseq Size | 1554 |
| Cytogenetics | 2 C3 |
| Refseq ORF | 939 |
| Synonyms | AV120107; lear; Pact; PRK; RAX |
| Summary | Required for siRNA production by DICER1 and for subsequent siRNA-mediated post-transcriptional gene silencing. Does not seem to be required for processing of pre-miRNA to miRNA by DICER1 (By similarity). Activates EIF2AK2/PKR in the absence of double-stranded RNA (dsRNA), leading to phosphorylation of EIF2S1/EFI2-alpha and inhibition of translation and induction of apoptosis. Promotes UBC9-p53/TP53 association and sumoylation and phosphorylation of p53/TP53 at 'Lys-386' at 'Ser-392' respectively and enhances its activity in a EIF2AK2/PKR-dependent manner.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
