Nlrp10 (NM_175532) Mouse Recombinant Protein
CAT#: TP523786
Purified recombinant protein of Mouse NLR family, pyrin domain containing 10 (Nlrp10), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
| Cited in 1 publication. |
Product images
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR223786 protein sequence
Red=Cloning site Green=Tags(s) MALARANSPQEALLWALNDLEENSFKTLKFHLRDVTQFHLARGELESLSQVDLASKLISMYGAQEAVRVV SRSLLAMNLMELVDYLNQVCLNDYREIYREHVRCLEERQDWGVNSSHNKLLLMATSSSGGRRSPSCSDLE QELDPVDVETLFAPEAESYSTPPIVVMQGSAGTGKTTLVKKLVQDWSKGKLYPGQFDYVFYVSCREVVLL PKCDLPNLICWCCGDDQAPVTEILRQPGRLLFILDGYDELQKSSRAECVLHILMRRREVPCSLLITTRPP ALQSLEPMLGERRHVLVLGFSEEERETYFSSCFTDKEQLKNALEFVQNNAVLYKACQVPGICWVVCSWLK KKMARGQEVSETPSNSTDIFTAYVSTFLPTDGNGDSSELTRHKVLKSLCSLAAEGMRHQRLLFEEEVLRK HGLDGPSLTAFLNCIDYRAGLGIKKFYSFRHISFQEFFYAMSFLVKEDQSQQGEATHKEVAKLVDPENHE EVTLSLQFLFDMLKTEGTLSLGLKFCFRIAPSVRQDLKHFKEQIEAIKYKRSWDLEFSLYDSKIKKLTQG IQMKDVILNVQHLDEKKSDKKKSVSVTSSFSSGKVQSPFLGNDKSTRKQKKASNGKSRGAEEPAPGVRNR RLASREKGHMEMNDKEDGGVEEQEDEEGQTLKKDGEMIDKMNG myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 76.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_780741 |
| Locus ID | 244202 |
| UniProt ID | Q8CCN1 |
| Refseq Size | 4483 |
| Cytogenetics | 7 E3 |
| Refseq ORF | 2019 |
| Synonyms | 6430548I20Rik; Nalp10; Napl10; PAN5; Pynod |
| Summary | Inhibits autoprocessing of CASP1, CASP1-dependent IL1B secretion, PYCARD aggregation and PYCARD-mediated apoptosis but not apoptosis induced by FAS or BID (By similarity). Displays anti-inflammatory activity (By similarity). Required for immunity against C.albicans infection (PubMed:23071280). Involved in the innate immune response by contributing to proinflammatory cytokine release in response to invasive bacterial infection (By similarity). Contributes to T-cell-mediated inflammatory responses in the skin (PubMed:27221772). Plays a role in protection against periodontitis through its involvement in induction of IL1A via ERK activation in oral epithelial cells infected with periodontal pathogens (By similarity). Exhibits both ATPase and GTPase activities (By similarity).[UniProtKB/Swiss-Prot Function] |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Glial uptake of amyloid beta induces NLRP3 inflammasome formation via cathepsin-dependent degradation of NLRP10.
,null,
Neuromolecular medicine
,PubMed ID 24197756
[Nlrp10]
|
Documents
| FAQs |
| SDS |
