SARS-CoV-2 Nsp7 Gene Tagged ORF Clone (Native Sequence)
CAT#: VC102577
- TrueORF®
mRFP-tagged ORF clone for SARS-CoV-2 NSP7 [Severe acute respiratory syndrome coronavirus 2], YP_009725303.1
View other clones from "SARS-CoV-2" (41)
Need custom modification / cloning service?
Get a free quote
CNY 1200.00
CNY 3800.00
Product images

CNY 600.00
Specifications
Product Data | |
Type | Virus Tagged ORF Clone |
Tag | mRFP |
Vector | pCMV6-AC-mRFP |
E. coli Selection | Ampicillin (100 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC102577 represents NCBI reference of YP_009725303
Blue=ORF Red=Cloning site Green=Tag(s) GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC ATGTCTAAAATGTCAGATGTAAAGTGCACATCAGTAGTCTTACTCTCAGTTTTGCAACAACTCAGAGTA GAATCATCATCTAAATTGTGGGCTCAATGTGTCCAGTTACACAATGACATTCTCTTAGCTAAAGATACT ACTGAAGCCTTTGAAAAAATGGTTTCACTACTTTCTGTTTTGCTTTCCATGCAGGGTGCTGTAGACATA AACAAGCTTTGTGAAGAAATGCTGGACAACAGGGCAACCTTACAAGCAGCAAATGATATCCTGGATTAC AAGGATGACGACGATAAGGTT ACGCGTACGCGGCCGCTCGAG - mRFP-Tag - TAA GTT TAA ACGGCCGGCCGCGG >VC102577 representing YP_009725303
Blue=ORF Red=Cloning site Green=Tag(s) MSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDI NKLCEEMLDNRATLQAANDILDYKDDDDKV TRTRPLE - mRFP-Tag - |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NC_045512 |
ORF Size | 276 bp |
OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NC_045512.2, YP_009725303.1 |
RefSeq ORF | 276 bp |
MW | 11.1 kDa |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC102555 | Myc-DDK-tagged ORF clone for SARS-CoV-2 nucleocapsid phosphoprotein [Severe acute respiratory syndrome coronavirus 2], YP_009724397 |
CNY 3656.00 |
|
VC102556 | Myc-DDK-tagged ORF clone for SARS-CoV-2 surface glycoprotein extracellular domain [Severe acute respiratory syndrome coronavirus 2], YP_009724390 |
CNY 8320.00 |
|
VC102557 | Myc-DDK-tagged ORF clone for SARS-CoV-2 surface glycoprotein [Severe acute respiratory syndrome coronavirus 2], codon optimized for human cell expression, YP_009724390. Note: ORF is codon optimized |
CNY 8864.00 |
|
VC102558 | Myc-DDK-tagged ORF clone for SARS-CoV-2 ORF3a protein [Severe acute respiratory syndrome coronavirus 2], codon optimized for human cell expression, YP_009724391. Note: ORF is codon optimized |
CNY 2400.00 |
|
VC102559 | Myc-DDK-tagged ORF clone for SARS-CoV-2 Membrane Glycoprotein [Severe acute respiratory syndrome coronavirus 2], codon optimized for human cell expression, YP_009724393. Note: ORF is codon optimized |
CNY 2400.00 |
|
VC102560 | Myc-DDK-tagged ORF clone for SARS-CoV-2 ORF6 protein [Severe acute respiratory syndrome coronavirus 2], codon optimized for human cell expression, YP_009724394 |
CNY 3800.00 |
|
VC102561 | Myc-DDK-tagged ORF clone for SARS-CoV-2 ORF7a protein [Severe acute respiratory syndrome coronavirus 2], codon optimized for human cell expression, YP_009724395 |
CNY 3800.00 |
|
VC102562 | Myc-DDK-tagged ORF clone for SARS-CoV-2 ORF8 protein [Severe acute respiratory syndrome coronavirus 2], codon optimized for human cell expression, YP_009724396 |
CNY 1200.00 |
|
VC102563 | Myc-DDK-tagged ORF clone for SARS-CoV-2 Nucleocapsid Phosphoprotein [Severe acute respiratory syndrome coronavirus 2], codon optimized for human cell expression, YP_009724397 |
CNY 3656.00 |
|
VC102564 | Myc-DDK-tagged ORF clone for SARS-CoV-2 ORF10 protein [Severe acute respiratory syndrome coronavirus 2], codon optimized for human cell expression, YP_009725255 |
CNY 3800.00 |
|
VC102565 | Myc-DDK-tagged ORF clone for SARS-CoV-2 Envelop Protein [Severe acute respiratory syndrome coronavirus 2], codon optimized for human cell expression, YP_009724392. Note: ORF is codon optimized |
CNY 1200.00 |
|
VC102566 | Myc-DDK-tagged ORF clone for SARS-CoV-2 surface glycoprotein [Severe acute respiratory syndrome coronavirus 2], YP_009724390 |
CNY 8864.00 |
|
VC102567 | Myc-DDK-tagged ORF clone for SARS-CoV-2 ORF3a protein [Severe acute respiratory syndrome coronavirus 2], YP_009724391 |
CNY 2400.00 |
|
VC102568 | Myc-DDK-tagged ORF clone for SARS-CoV-2 Membrane Glycoprotein [Severe acute respiratory syndrome coronavirus 2], YP_009724393 |
CNY 2400.00 |
|
VC102569 | Myc-DDK-tagged ORF clone for SARS-CoV-2 ORF6 protein [Severe acute respiratory syndrome coronavirus 2], YP_009724394 |
CNY 1200.00 |
|
VC102570 | Myc-DDK-tagged ORF clone for SARS-CoV-2 ORF7a protein [Severe acute respiratory syndrome coronavirus 2], YP_009724395 |
CNY 1200.00 |
|
VC102571 | Myc-DDK-tagged ORF clone for SARS-CoV-2 ORF8 protein [Severe acute respiratory syndrome coronavirus 2], YP_009724396 |
CNY 1200.00 |
|
VC102572 | Myc-DDK-tagged ORF clone for SARS-CoV-2 ORF10 protein [Severe acute respiratory syndrome coronavirus 2], YP_009725255 |
CNY 1200.00 |
|
VC102573 | Myc-DDK-tagged ORF clone for SARS-CoV-2 Envelop Protein [Severe acute respiratory syndrome coronavirus 2], YP_009724392 |
CNY 1200.00 |
|
VC102574 | mRFP-tagged ORF clone for SARS-CoV-2 NSP4 [Severe acute respiratory syndrome coronavirus 2], YP_009725300.1 |
CNY 3840.00 |
|
VC102575 | mRFP-tagged ORF clone for SARS-CoV-2 NSP5 [Severe acute respiratory syndrome coronavirus 2], YP_009725301.1 |
CNY 2400.00 |
|
VC102576 | mRFP-tagged ORF clone for SARS-CoV-2 NSP6 [Severe acute respiratory syndrome coronavirus 2], YP_009725302.1 |
CNY 2400.00 |
|
VC102578 | mRFP-tagged ORF clone for SARS-CoV-2 NSP8 [Severe acute respiratory syndrome coronavirus 2], YP_009725304.1 |
CNY 2400.00 |
|
VC102579 | mRFP-tagged ORF clone for SARS-CoV-2 NSP9 [Severe acute respiratory syndrome coronavirus 2], YP_009725305.1 |
CNY 1200.00 |
|
VC102580 | mRFP-tagged ORF clone for SARS-CoV-2 NSP10 [Severe acute respiratory syndrome coronavirus 2], YP_009725306.1 |
CNY 1200.00 |
|
VC102581 | mRFP-tagged ORF clone for SARS-CoV-2 NSP14 [Severe acute respiratory syndrome coronavirus 2], YP_009725309.1 |
CNY 4040.00 |
|
VC102582 | mRFP-tagged ORF clone for SARS-CoV-2 ORF3a [Severe acute respiratory syndrome coronavirus 2], YP_009724391.1 |
CNY 2400.00 |
|
VC102583 | mRFP-tagged ORF clone for SARS-CoV-2 M protein [Severe acute respiratory syndrome coronavirus 2], YP_009724393.1 |
CNY 2400.00 |
|
VC102584 | mRFP-tagged ORF clone for SARS-CoV-2 ORF9b [Severe acute respiratory syndrome coronavirus 2], YP_009724397.2 |
CNY 1200.00 |
|
VC102585 | mRFP-tagged ORF clone for SARS-CoV-2 ORF9c [Severe acute respiratory syndrome coronavirus 2], YP_009724397.2 |
CNY 1200.00 |
|
VC102586 | mRFP-tagged ORF clone for SARS-CoV-2 ORF10 [Severe acute respiratory syndrome coronavirus 2], YP_009725255.1 |
CNY 1200.00 |
|
VC102587 | Myc-DDK-tagged ORF clone for SARS-CoV-2 surface glycoprotein mutant (D614G) [Severe acute respiratory syndrome coronavirus 2], YP_009724390 |
CNY 8864.00 |
|
VC202557 | Native cDNA clone for SARS-CoV-2 surface glycoprotein [Severe acute respiratory syndrome coronavirus 2], YP_009724390 |
CNY 8872.00 |
|
VC202558 | Native cDNA clone for SARS-CoV-2 ORF3a protein [Severe acute respiratory syndrome coronavirus 2], YP_009724391 |
CNY 2400.00 |
|
VC202559 | Native cDNA clone for SARS-CoV-2 Membrane Glycoprotein [Severe acute respiratory syndrome coronavirus 2], YP_009724393 |
CNY 2400.00 |
|
VC202560 | Native cDNA clone for SARS-CoV-2 ORF6 protein [Severe acute respiratory syndrome coronavirus 2], YP_009724394 |
CNY 3800.00 |
|
VC202561 | Native cDNA clone for SARS-CoV-2 ORF7a protein [Severe acute respiratory syndrome coronavirus 2], YP_009724395 |
CNY 3800.00 |
|
VC202562 | Native cDNA clone for SARS-CoV-2 ORF8 protein [Severe acute respiratory syndrome coronavirus 2], YP_009724396 |
CNY 3800.00 |
|
VC202563 | Native cDNA clone for SARS-CoV-2 Nucleocapsid Phosphoprotein [Severe acute respiratory syndrome coronavirus 2], YP_009724397 |
CNY 3656.00 |
|
VC202564 | Native cDNA clone for SARS-CoV-2 ORF10 protein [Severe acute respiratory syndrome coronavirus 2], YP_009725255 |
CNY 3800.00 |
|
VC202565 | Native cDNA clone for SARS-CoV-2 Envelop Protein [Severe acute respiratory syndrome coronavirus 2], YP_009724392 |
CNY 3800.00 |