OBP2A (NM_014582) Human Mass Spec Standard
CAT#: PH310114
OBP2A MS Standard C13 and N15-labeled recombinant protein (NP_055397)
View other "OBP2A" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | OBP2A MS Standard C13 and N15-labeled recombinant protein (NP_055397) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210114 |
Predicted MW | 19.32 kDa |
Protein Sequence |
>RC210114 representing NM_014582
Red=Cloning site Green=Tags(s) MKTLFLGVTLGLAAALSFTLEEEDITGTWYVKAMVVDKDFPEDRRPRKVSPVKVTALGGGNLEATFTFMR EDRCIQKKILMRKTEEPGKFSAYGGRKLIYLQELPGTDDYVFYCKDQRRGGLRYMGKLVGRNPNTNLEAL EEFKKLVQHKGLSEEDIFMPLQTGSCVLEH myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_055397 |
RefSeq Size | 689 |
RefSeq ORF | 510 |
Synonyms | hOBPIIa; LCN13; OBP; OBP2C; OBPIIa |
Locus ID | 29991 |
Cytogenetics | 9q34.3 |
Summary | This gene encodes a small extracellular protein belonging to the lipocalin superfamily. The protein is thought to transport small, hydrophobic, volatile molecules or odorants through the nasal mucus to olfactory receptors, and may also function as a scavenger of highly concentrated or toxic odors. The protein is expressed as a monomer in the nasal mucus, and can bind diverse types of odorants with a higher affinity for aldehydes and fatty acids. This gene and a highly similar family member are located in a cluster of lipocalin genes on chromosome 9. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415182 | OBP2A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415182 | Transient overexpression lysate of odorant binding protein 2A (OBP2A) |
CNY 3080.00 |
|
TP310114 | Recombinant protein of human odorant binding protein 2A (OBP2A), 20 µg |
CNY 2900.00 |