SPIN2B (NM_001006681) Human Mass Spec Standard
CAT#: PH310041
SPIN2B MS Standard C13 and N15-labeled recombinant protein (NP_001006682)
View other "SPIN2B" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | SPIN2B MS Standard C13 and N15-labeled recombinant protein (NP_001006682) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210041 |
Predicted MW | 29.2 kDa |
Protein Sequence |
>RC210041 protein sequence
Red=Cloning site Green=Tags(s) MKTPNAQEAEGQQTRAAAGRATGSANMTKKKVSQKKQRGRPSSQPRRNIVGCRISHGWKEGDEPITQWKG TVLDQVPINPSLYLVKYDGIDCVYGLELHRDERVLSLKILSDRVASSHISDANLANTIIGKAVEHMFEGE HGSKDEWRGMVLAQAPIMKAWFYITYEKDPVLYMYQLLDDYKEGDLRIMPESSESPPTEREPGGVVDGLI GKHVEYTKEDGSKRIGMVIHQVEAKPSVYFIKFDDDFHIYVYDLVKKS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001006682 |
RefSeq Size | 1277 |
RefSeq ORF | 774 |
Synonyms | dJ323P24.2; SPIN-2; SPIN-2B; SPIN2_duplicate; TDRD26 |
Locus ID | 474343 |
Cytogenetics | Xp11.21 |
Summary | Involved in the regulation of cell cycle progression, this activity is related to the inhibition of apoptosis following the removal of essential growth factors (PubMed:12145692). Exhibits H3K4me3-binding activity (PubMed:29061846).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC423547 | SPIN2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423549 | SPIN2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY423547 | Transient overexpression lysate of spindlin family, member 2B (SPIN2B), transcript variant 1 |
CNY 3080.00 |
|
LY423549 | Transient overexpression lysate of spindlin family, member 2B (SPIN2B), transcript variant 3 |
CNY 3080.00 |
|
PH313224 | SPIN2B MS Standard C13 and N15-labeled recombinant protein (NP_001006684) |
CNY 19520.00 |
|
TP310041 | Recombinant protein of human spindlin family, member 2B (SPIN2B), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP313224 | Recombinant protein of human spindlin family, member 2B (SPIN2B), transcript variant 3, 20 µg |
CNY 2900.00 |