SPIN2B (NM_001006683) Human Recombinant Protein
CAT#: TP313224
Recombinant protein of human spindlin family, member 2B (SPIN2B), transcript variant 3, 20 µg
View other "SPIN2B" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC213224 protein sequence
Red=Cloning site Green=Tags(s) MKTPNAQEAEGQQTRAAAGRATGSANMTKKKVSQKKQRGRPSSQPRRNIVGCRISHGWKEGDEPITQWKG TVLDQVPINPSLYLVKYDGIDCVYGLELHRDERVLSLKILSDRVASSHISDANLANTIIGKAVEHMFEGE HGSKDEWRGMVLAQAPIMKAWFYITYEKDPVLYMYQLLDDYKEGDLRIMPESSESPPTEREPGGVVDGLI GKHVEYTKEDGSKRIGMVIHQVEAKPSVYFIKFDDDFHIYVYDLVKKS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 29 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001006684 |
Locus ID | 474343 |
UniProt ID | Q9BPZ2 |
Refseq Size | 1216 |
Cytogenetics | Xp11.21 |
Refseq ORF | 774 |
Synonyms | dJ323P24.2; SPIN-2; SPIN-2B; SPIN2_duplicate; TDRD26 |
Summary | Involved in the regulation of cell cycle progression, this activity is related to the inhibition of apoptosis following the removal of essential growth factors (PubMed:12145692). Exhibits H3K4me3-binding activity (PubMed:29061846).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC423547 | SPIN2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423549 | SPIN2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY423547 | Transient overexpression lysate of spindlin family, member 2B (SPIN2B), transcript variant 1 |
CNY 3080.00 |
|
LY423549 | Transient overexpression lysate of spindlin family, member 2B (SPIN2B), transcript variant 3 |
CNY 3080.00 |
|
PH310041 | SPIN2B MS Standard C13 and N15-labeled recombinant protein (NP_001006682) |
CNY 19520.00 |
|
PH313224 | SPIN2B MS Standard C13 and N15-labeled recombinant protein (NP_001006684) |
CNY 19520.00 |
|
TP310041 | Recombinant protein of human spindlin family, member 2B (SPIN2B), transcript variant 1, 20 µg |
CNY 2900.00 |