SPIN2B (NM_001006681) Human Recombinant Protein
CAT＃: TP310041
Recombinant protein of human spindlin family, member 2B (SPIN2B), transcript variant 1, 20 µg
View other "SPIN2B" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC210041 protein sequence
Red=Cloning site Green=Tags(s) MKTPNAQEAEGQQTRAAAGRATGSANMTKKKVSQKKQRGRPSSQPRRNIVGCRISHGWKEGDEPITQWKG TVLDQVPINPSLYLVKYDGIDCVYGLELHRDERVLSLKILSDRVASSHISDANLANTIIGKAVEHMFEGE HGSKDEWRGMVLAQAPIMKAWFYITYEKDPVLYMYQLLDDYKEGDLRIMPESSESPPTEREPGGVVDGLI GKHVEYTKEDGSKRIGMVIHQVEAKPSVYFIKFDDDFHIYVYDLVKKS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 29 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001006682 |
| Locus ID | 474343 |
| UniProt ID | Q9BPZ2 |
| Refseq Size | 1277 |
| Cytogenetics | Xp11.21 |
| Refseq ORF | 774 |
| Synonyms | dJ323P24.2; SPIN-2; SPIN-2B; SPIN2_duplicate; TDRD26 |
| Summary | Involved in the regulation of cell cycle progression, this activity is related to the inhibition of apoptosis following the removal of essential growth factors (PubMed:12145692). Exhibits H3K4me3-binding activity (PubMed:29061846).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC423547 | SPIN2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423549 | SPIN2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY423547 | Transient overexpression lysate of spindlin family, member 2B (SPIN2B), transcript variant 1 |
CNY 3080.00 |
|
| LY423549 | Transient overexpression lysate of spindlin family, member 2B (SPIN2B), transcript variant 3 |
CNY 3080.00 |
|
| PH310041 | SPIN2B MS Standard C13 and N15-labeled recombinant protein (NP_001006682) |
CNY 19520.00 |
|
| PH313224 | SPIN2B MS Standard C13 and N15-labeled recombinant protein (NP_001006684) |
CNY 19520.00 |
|
| TP313224 | Recombinant protein of human spindlin family, member 2B (SPIN2B), transcript variant 3, 20 µg |
CNY 2900.00 |
