SPIN2B (NM_001006683) Human Mass Spec Standard
CAT#: PH313224
SPIN2B MS Standard C13 and N15-labeled recombinant protein (NP_001006684)
View other "SPIN2B" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | SPIN2B MS Standard C13 and N15-labeled recombinant protein (NP_001006684) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC213224 |
| Predicted MW | 29.2 kDa |
| Protein Sequence |
>RC213224 protein sequence
Red=Cloning site Green=Tags(s) MKTPNAQEAEGQQTRAAAGRATGSANMTKKKVSQKKQRGRPSSQPRRNIVGCRISHGWKEGDEPITQWKG TVLDQVPINPSLYLVKYDGIDCVYGLELHRDERVLSLKILSDRVASSHISDANLANTIIGKAVEHMFEGE HGSKDEWRGMVLAQAPIMKAWFYITYEKDPVLYMYQLLDDYKEGDLRIMPESSESPPTEREPGGVVDGLI GKHVEYTKEDGSKRIGMVIHQVEAKPSVYFIKFDDDFHIYVYDLVKKS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001006684 |
| RefSeq Size | 1216 |
| RefSeq ORF | 774 |
| Synonyms | dJ323P24.2; SPIN-2; SPIN-2B; SPIN2_duplicate; TDRD26 |
| Locus ID | 474343 |
| Cytogenetics | Xp11.21 |
| Summary | Involved in the regulation of cell cycle progression, this activity is related to the inhibition of apoptosis following the removal of essential growth factors (PubMed:12145692). Exhibits H3K4me3-binding activity (PubMed:29061846).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC423547 | SPIN2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423549 | SPIN2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY423547 | Transient overexpression lysate of spindlin family, member 2B (SPIN2B), transcript variant 1 |
CNY 3080.00 |
|
| LY423549 | Transient overexpression lysate of spindlin family, member 2B (SPIN2B), transcript variant 3 |
CNY 3080.00 |
|
| PH310041 | SPIN2B MS Standard C13 and N15-labeled recombinant protein (NP_001006682) |
CNY 19520.00 |
|
| TP310041 | Recombinant protein of human spindlin family, member 2B (SPIN2B), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP313224 | Recombinant protein of human spindlin family, member 2B (SPIN2B), transcript variant 3, 20 µg |
CNY 2900.00 |
